DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31102 and H06H21.8

Sequence 1:NP_001262951.1 Gene:CG31102 FlyBaseID:FBgn0051102 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001023255.1 Gene:H06H21.8 WormBaseID:WBGene00019164 Length:388 Species:Caenorhabditis elegans

Alignment Length:412 Identity:84/413 (20%)
Similarity:143/413 (35%) Gaps:102/413 (25%)


  Fly    29 LKREFREFRRILNLSIIPATPPGETY--------------TSLLMRIVIDIELK---DGFSQQKS 76
            :|.:.::.||::..|.    |..|.:              .|....|.: ..||   ||....:|
 Worm     1 MKAKLKQLRRLVESSF----PEIENFHEKVDASFEKLENAKSFWSEIYV-AHLKVVGDGVKVPES 60

  Fly    77 YIVKT--------MLDDAQGNGGFVNTLNIFPKEKMMYETIIPNLEQLYEEAGLSVKFA-PKCHH 132
            ..:|.        ..:|...    ||.||    :.::|.:...||...:.|.|....|. ||.:.
 Worm    61 VFIKVPRISENVLRCEDESA----VNHLN----DVLLYYSKKENLFYKHFEYGSIPNFPFPKVYF 117

  Fly   133 AEDIKGRIC--LVQEDLQTKKYRNINRLKGFDMAHMHRVLEKLAEFHA---------------AG 180
            .|||.|...  :|.|:|..|.:. :..:.|.....:.|::|.||..|:               .|
 Worm   118 TEDINGEATGGIVAENLSEKVFA-VEHIPGLKHEQILRLMEALAGLHSFLMKRDDKSYVESFVEG 181

  Fly   181 AVWRQRKGPFPDDFQRIYLP-----ANYQKSKSYQARLQSYKTAIASWGLADHEQYVSRIPTADQ 240
            |..|:   .|.:..|.:...     .|.........|:::.|     |..   :..:....|||.
 Worm   182 AHGRE---TFSEGMQNMMFEEALTLENVSPEVFGNDRIRNIK-----WSF---DYSIKNKATADA 235

  Fly   241 FVQSYASCFNNNPQEFKVLNHGDFWSSNIMLSYTQTGD-INQVRFVDFQLCKWGSPAQDLWELII 304
            .     |.|..      ::.|.|...:|::.......| |:.:  :|:|:...||.|.|:..::.
 Worm   236 I-----SAFPG------IICHADLNVTNVLWKKDSAKDEISAI--IDYQMLFIGSIAFDIIRVLT 287

  Fly   305 CSARHSIRIQYFDYFIRIYHTHLVRCLKILKYSERIPMLRE--LHMSMIKYGFWGYFTTFTHLVF 367
            ......||.:....::..||..|...     .:.:.|...|  ||...:.|.|...|:.|...::
 Worm   288 LGLNREIRRKMTQNYLDHYHKTLTEL-----SNGKAPFSMEELLHQYSLIYPFSSNFSLFGIALY 347

  Fly   368 ILL--------PPDTEASLVKL 381
            |.:        |.|.|.:..:|
 Worm   348 IKMYSDGTLGNPEDKEENCKEL 369

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31102NP_001262951.1 EcKinase 50..336 CDD:281023 66/335 (20%)
H06H21.8NP_001023255.1 CHK 129..312 CDD:214734 40/208 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.857 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.