DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31102 and F59B1.8

Sequence 1:NP_001262951.1 Gene:CG31102 FlyBaseID:FBgn0051102 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_504022.2 Gene:F59B1.8 WormBaseID:WBGene00019100 Length:420 Species:Caenorhabditis elegans

Alignment Length:299 Identity:56/300 (19%)
Similarity:108/300 (36%) Gaps:61/300 (20%)


  Fly   118 EEAGLSVKFAPKCHHAEDIKGRIC---------LVQEDLQTKKYRNINRLKGF------------ 161
            |||.:...|...|....:::...|         |:.:...::|:...|..|||            
 Worm   105 EEAHVHAHFEKSCQKGHNLEVEFCEAFGHLEGLLLPKVFFSQKFEEDNPNKGFVGMEFVEGSVVR 169

  Fly   162 ------DMAHMHRVLEKLAEFHAAGAVWRQRKGPFPDDFQRIYLPANYQKSKSYQARLQSYKTAI 220
                  .:..:..:|:.||...|........:              |....::::..|....:..
 Worm   170 HCYENVTVDELQPILKALARLQALSLSTESCR--------------NLDNGEAFEESLMDMLSED 220

  Fly   221 ASWGLADH--------EQYVSRIPTADQFVQSYASCFNNNPQ---EFKVLNHGDFWSSNIMLSYT 274
            ...|:.|.        .:.|.||....:.:.:..:..|.|..   :.||:.|||.|::||:.:.|
 Worm   221 GLKGIFDQSRNIDQKLSEKVERIEQNHKEILNLETVLNLNKVVGIDQKVICHGDLWAANILWTQT 285

  Fly   275 QTGDINQVRFVDFQLCKWGSPAQDLWELIICSARHSIRIQYFDYFIRIYHTHLVRCLKILKYSER 339
            ..|.|.. :.:|:|....|:||:||..|::.:...:.|..::::.:..::|:....:.    |..
 Worm   286 DGGFIAD-KVLDYQESHMGNPAEDLVRLLVSTISGADRQSHWEHILEQFYTYFTDEIG----SNN 345

  Fly   340 IPMLRELHMSMIKYGFWGYFTTFTHLVFILLPPDTEASL 378
            .|...|    .:|..|..||......:..|..|..:..|
 Worm   346 APYTLE----QLKTSFKLYFPVGALTLISLFGPAVDMKL 380

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31102NP_001262951.1 EcKinase 50..336 CDD:281023 46/256 (18%)
F59B1.8NP_504022.2 DUF1679 8..414 CDD:285194 56/300 (19%)
APH 124..338 CDD:279908 41/229 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4024
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.950

Return to query results.
Submit another query.