DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: nonA and CG4266

Sequence 1:NP_727962.1 Gene:nonA FlyBaseID:FBgn0004227 Length:742 Species:Drosophila melanogaster
Sequence 2:NP_001097394.1 Gene:CG4266 FlyBaseID:FBgn0034598 Length:1306 Species:Drosophila melanogaster

Alignment Length:351 Identity:96/352 (27%)
Similarity:128/352 (36%) Gaps:109/352 (31%)


  Fly    16 PQRQQRGN-----------QQANKNLGKHNAQKQNDSADGGPAEKKQRFGGPN--AQNQNQNQNQ 67
            ||:|...|           ..||:...:.:.::..|:.|........|:||.:  .:...:.:.:
  Fly   794 PQQQANFNPSPSNVDLSPAAMANEMFQQRDRERDRDNRDRSRGPGNSRWGGRDDVVEAAERWRAE 858

  Fly    68 NGGVTGGGGAVGGPNQNKNFG---------------------NNKGGFVGNRNR----NNNRAGN 107
            |||..||.|:..|||...|..                     :|:||..|.|..    |:|..|.
  Fly   859 NGGGGGGPGSGLGPNAAFNEARARLNLNPIEHGMPRPDFMDFDNRGGPGGPRGMGPRGNHNGGGP 923

  Fly   108 QNRTFPGNNNPNQKPNNETSKADGPNALAKNNEPATAAAGQNQANQNANKGQNQRQGQNQNQNQV 172
            ....||.|.|.|        :.:.|.:|.:...|..|:..|.......|.|              
  Fly   924 GGDFFPPNMNHN--------RFNQPTSLMQMRIPPPASFNQRMGGPAGNGG-------------- 966

  Fly   173 HGQG-----NQGGPGNQGGAGNQGGQGNQGGAGNQGNGQGFRGRNAGNNQGGGFSGGPQNQQRDN 232
            :|.|     |||  |..||||..|  |..||||..|.|.|      |..||.||. .|:|...||
  Fly   967 NGVGPMFMRNQG--GGPGGAGPSG--GGPGGAGTGGGGPG------GRQQGPGFF-NPRNPFNDN 1020

  Fly   233 RNRSGPRPGGGAGGAMNSTNMGGGGGGGGGGGPR-------GGEDFFITQRLRSISGPTFELEPV 290
            :...|.:.|||..|      :|||||||.||..|       ||.:|   :|.....||       
  Fly  1021 QRGRGGQSGGGVRG------VGGGGGGGPGGRGRWSDDEDEGGNNF---KRRGGPGGP------- 1069

  Fly   291 EVPTETKFSGRNRLYVGNLTNDITDD 316
                     |.|| :.|....::.||
  Fly  1070 ---------GGNR-FRGERGGEMMDD 1085

Known Domains:


GeneSequenceDomainRegion External IDIdentity
nonANP_727962.1 RRM1_p54nrb_like 301..371 CDD:240778 5/17 (29%)
RRM2_p54nrb_like 377..456 CDD:240779
NOPS_NONA_like 447..546 CDD:240580
GBP_C <508..613 CDD:303769
coiled coil 584..595 CDD:293879
coiled coil 603..613 CDD:293879
CG4266NP_001097394.1 CID 7..125 CDD:239621
RRM <488..>593 CDD:223796
RRM_SCAF4_SCAF8 490..566 CDD:240673
DUF2413 1147..>1254 CDD:287302
Herpes_DNAp_acc <1206..1304 CDD:282746
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23189
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.