DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: caz and Ewsr1

Sequence 1:NP_523365.2 Gene:caz FlyBaseID:FBgn0285954 Length:399 Species:Drosophila melanogaster
Sequence 2:XP_006514571.1 Gene:Ewsr1 MGIID:99960 Length:668 Species:Mus musculus

Alignment Length:456 Identity:179/457 (39%)
Similarity:224/457 (49%) Gaps:73/457 (16%)


  Fly     2 ERGGYGGGSGQGYNNFAVPPPNYQQMPNKTGNYNEPPPNYGKQGGGYDSGSGHRGSGGSGNG--G 64
            ::..||..|..|..    ||.:|   |.:||:|::.|..|.:|...|...|..|....|..|  |
Mouse   228 QQSSYGQQSSYGQQ----PPTSY---PPQTGSYSQAPSQYSQQSSSYGQQSSFRQDHPSSMGVYG 285

  Fly    65 GGGGSWNDRGGNSYGNGGASKDSYNKGHGGYSGGG---GGGGGGGGG-GSGGN------------ 113
            ...|.::..|.|...:|   .|:..:|.||:..||   ||.|||.|| ||.|.            
Mouse   286 QESGGFSGPGENRSLSG---PDNRGRGRGGFDRGGMSRGGRGGGRGGLGSAGERGGFNKPGGPMD 347

  Fly   114 -------------DMITQEDTIFVSGMDPSTTEQDIETHFGAIGIIKKDKRTMKPKIWLYKNKET 165
                         |..:....|:|.|::.:.|..|:...|...|::|.:|||.:|.|.:|.:|||
Mouse   348 EGPDLDLGLPIDPDEDSDNSAIYVQGLNDNVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKET 412

  Fly   166 GASKGEATVTYDDTNAAQSAIEWFDGRDFNGNAIKVSLAQRQNNWNKGGGGGGGGGGRGGFGGRR 230
            |..||:|||:|:|...|::|:|||||:||.|:.:|||||:::...|...||.....|||.....|
Mouse   413 GKPKGDATVSYEDPPTAKAAVEWFDGKDFQGSKLKVSLARKKPPMNSMRGGMPPREGRGMPPPLR 477

  Fly   231 GGGGGGGGGGGGGGRFDRGGGGGGGRYDRG--GGGGGGGGGGNVQPRDGDWKCNS--CNNTNFAW 291
            ||.||.||.||..||....||..||...||  |..|...||||||.|.|||:|.:  |.|.||||
Mouse   478 GGPGGPGGPGGPMGRMGGRGGDRGGFPPRGPRGSRGNPSGGGNVQHRAGDWQCPNPGCGNQNFAW 542

  Fly   292 RNECNRCKTPK------------GDDEGSSGGGG-GGGYGG----GGGGGGY--DRGNDRGSGGG 337
            |.|||:||.||            |.|.|..|.|| .||.||    ||.||.:  .||.|||...|
Mouse   543 RTECNQCKAPKPEGFLPPPFPPPGGDRGRGGPGGMRGGRGGLMDRGGPGGMFRGGRGGDRGGFRG 607

  Fly   338 GYHNRDRGGNSQGGGGGGGGGGGYSRFNDNNGGGRGGRGGGGGNRRDGGPMRNDG----GMRSRP 398
            | ...||||  .|||..||.||......:..||.||||||.|  :.|..|:...|    ..|.||
Mouse   608 G-RGMDRGG--FGGGRRGGPGGPPGPLMEQMGGRRGGRGGPG--KMDKVPLLCRGEHRQERRDRP 667

  Fly   399 Y 399
            |
Mouse   668 Y 668

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cazNP_523365.2 RRM <118..>205 CDD:223796 40/87 (46%)
RRM_SARFH 122..204 CDD:240978 39/82 (48%)
zf-RanBP 275..304 CDD:279035 20/43 (47%)
RanBP2-type Zn finger 279..298 CDD:275375 12/21 (57%)
Ewsr1XP_006514571.1 RRM <360..>461 CDD:223796 42/101 (42%)
RRM_EWS 367..450 CDD:240977 38/83 (46%)
zf-RanBP 524..553 CDD:279035 18/29 (62%)
RanBP2-type Zn finger 528..549 CDD:275375 12/21 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C117262229
eggNOG 1 0.900 E1_KOG1995
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 298 1.000 Inparanoid score I2685
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1539664at2759
OrthoFinder 1 1.000 FOG0002200
OrthoInspector 1 1.000 T1082919
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23238
Phylome 1 0.910 0.750 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4499
TreeFam 1 0.960
109.890

Return to query results.
Submit another query.