DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: disco and Bnc2

Sequence 1:NP_001033847.1 Gene:disco FlyBaseID:FBgn0000459 Length:568 Species:Drosophila melanogaster
Sequence 2:XP_008761997.2 Gene:Bnc2 RGDID:1310694 Length:1135 Species:Rattus norvegicus

Alignment Length:454 Identity:127/455 (28%)
Similarity:171/455 (38%) Gaps:140/455 (31%)


  Fly    69 RRWGSPPINLAGQFINPATGKKRVQCSICFKTFCDKGALKIHFSAVHLREMHKCTVEGCNMVFSS 133
            ||.||            |:.|.||.|:.|.|||.|||.||||::||||:..|:||:|||||||||
  Rat   466 RRMGS------------ASRKGRVFCNACGKTFYDKGTLKIHYNAVHLKIKHRCTIEGCNMVFSS 518

  Fly   134 RRSRNRHSANPNPKLHSPHIRRK------------ISPHDGRTAQQFPVFSPG-------TAAAA 179
            .||||||||||||:||.|.:|..            .:|....|.....:.|||       |....
  Rat   519 LRSRNRHSANPNPRLHMPMLRNNRDKDLIRATSGAATPVIASTKSNLTLTSPGRPPMGFTTPPLD 583

  Fly   180 AAVAGRLP--VAFPGL-------------------------LP--------------PPPPHHGH 203
            ..:...||  :.|.||                         ||              ||||....
  Rat   584 PVLQNPLPSQLVFSGLKTVQPVPPFYRSLLTPGEMVSPPTSLPTSPIIPTSGTIEQHPPPPSEPI 648

  Fly   204 HPYVMFGGQAGLHGLGLLSTGCQDPDSGS---------VDNEQDADPEDD--ND--FVYVDM--- 252
            .|.||.    |.|..|......:.|...|         :|...:.|.|||  ||  .|..||   
  Rat   649 VPAVMM----GTHEPGADLAPKKKPRKSSMPVKIEKEIIDTADEFDDEDDDPNDGGTVVNDMSHG 709

  Fly   253 ----QANSSSPAASSEDQEEHERDNEQDEEMHCSLSLASSSSIAADEERAADQPLDFSLHKRRKS 313
                ..:..||..|.:|..:|.|                :..|:..|.|.||.          .:
  Rat   710 NHCHSQDEMSPGMSVKDFSKHNR----------------TRCISRTEIRRADS----------MT 748

  Fly   314 EQDREQEQEQEQEREREAEKEQEQDVESDKEHEPEQEHEL----EREKRSPSDAFSMDQLLGKRK 374
            .:|:|.|::.|.|.|....|..|:.:..|:....|...::    ||...:.|:....|.:..|.:
  Rat   749 SEDQEPERDYENESESSEPKLGEESMVEDEHIHSEVSDKVLMNSERADENHSEPSHQDVIKVKEE 813

  Fly   375 RHDST-----------ASSSACSTAAASSASSSSASASANPPQTSIKMDL--DPDSDSAYMTSR 425
            ..|.|           .:....|.||...:.:||.: ..:|.:.|.:.||  .||....|:..:
  Rat   814 FTDPTYDMFYMSQYGLYNGGGASMAALHDSFTSSLN-YGSPQKFSPEGDLCSSPDPKICYVCKK 876



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C268973037
eggNOG 1 0.900 E1_2C0EZ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D59377at33208
OrthoFinder 1 1.000 FOG0001583
OrthoInspector 1 1.000 T131163
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR15021
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.