DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: disco and bnc2

Sequence 1:NP_001033847.1 Gene:disco FlyBaseID:FBgn0000459 Length:568 Species:Drosophila melanogaster
Sequence 2:XP_002935715.2 Gene:bnc2 XenbaseID:XB-GENE-953157 Length:1022 Species:Xenopus tropicalis

Alignment Length:562 Identity:143/563 (25%)
Similarity:206/563 (37%) Gaps:185/563 (33%)


  Fly     5 MNPFMSPAYLLGHGPH----SHQHVHSHLPSH---------------PQP----------NAAS- 39
            :||..:|  :||..|:    .|..:....||:               |.|          ||.| 
 Frog   250 INPVSAP--MLGLPPNGLMLEHPGLRLREPSNSNQNECEESSESEVSPMPYSRNEQPSNRNALSS 312

  Fly    40 -----PASSPGGSSG---SGSGSAAGSGTGSGSSLK---PRRWGSPPINLAGQFINPATGKKRVQ 93
                 |.:.|..:|.   |...|.......:.:|.|   .||.||            ::.|.||.
 Frog   313 ITNVEPKTEPTNASPTQCSTPVSEINKSEHTKTSFKIHRMRRMGS------------SSRKGRVF 365

  Fly    94 CSICFKTFCDKGALKIHFSAVHLREMHKCTVEGCNMVFSSRRSRNRHSANPNPKLHSPHIRRK-- 156
            |:.|.|||.|||.||||::||||:..|:||:|||||||||.||||||||||||:||.|.:|..  
 Frog   366 CNACGKTFYDKGTLKIHYNAVHLKIKHRCTIEGCNMVFSSLRSRNRHSANPNPRLHMPMLRNNRD 430

  Fly   157 ----------ISPHDGRTAQQFPVFSPGTAAAAAAVAGRLPV---------AFPGL--LPPPPPH 200
                      .:|....|.....:.|||......:.....|:         .||.|  :.|.||.
 Frog   431 KDLIRATSGAATPVIASTKSSLTLTSPGRPPLGFSTPPLDPILQNTLSNHLVFPALKTVQPVPPF 495

  Fly   201 H------GHHPYVMFGGQAGLHGLGLL--STGCQDP------------DSGSV------DNEQDA 239
            :      |.    |......|....::  |.|.:.|            .|||:      |:..|.
 Frog   496 YRSLLNSGD----MVSPPTSLPTSPIMPSSLGVEQPLPLPPSLPLPSELSGSMIGVTIHDSNADQ 556

  Fly   240 DPEDDNDFVYVDMQANSSSP---------AASSEDQEEHE------------RDNEQDEEMHCSL 283
            .|:        .....||.|         .|...|:||.|            .|:...::|...|
 Frog   557 APK--------KKPRKSSMPVKIEKEVIDTADEFDEEEEENIDHGPSTNDMGHDSHSQDDMSPGL 613

  Fly   284 SLAS------SSSIAADEERA-----ADQPLDFSLHKRRKSEQDREQEQEQEQEREREAEKEQEQ 337
            |:.|      |..|...:.||     .||            |.||:.|.|......:..::..|.
 Frog   614 SVNSFSKNSGSRCIRRTDTRANSVTSEDQ------------EHDRDFENESVSSEPKYCDEPMED 666

  Fly   338 D-------------VESDKEHEP----EQEHELEREKRSPSDAFSMDQLLGKRKRHDSTASSSAC 385
            |             :::||.:|.    .|:..::.::.....|:.|..:......:.::||.:|.
 Frog   667 DHLPLHKEHSVRSMMDNDKSYENHIDCHQQAVIKVKEEFTDPAYDMFYMSHYGLYNGNSASMAAL 731

  Fly   386 STAAASSASSSSASASANPPQTSIKMDL--DPDSDSAYMTSR 425
            ..:.|||.:..|      ||:.|.:.||  .||....|:..:
 Frog   732 HESLASSLNYGS------PPKFSPEGDLCSSPDPKICYVCKK 767

Known Domains:


GeneSequenceDomainRegion External IDIdentity
discoNP_001033847.1 None
bnc2XP_002935715.2 C2H2 Zn finger 366..387 CDD:275368 14/21 (67%)
C2H2 Zn finger 394..412 CDD:275368 16/18 (89%)
C2H2 Zn finger 762..783 CDD:275368 1/7 (14%)
C2H2 Zn finger 790..808 CDD:275368
C2H2 Zn finger 960..981 CDD:275368
C2H2 Zn finger 988..1006 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C268964059
eggNOG 1 0.900 E1_2C0EZ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D59377at33208
OrthoFinder 1 1.000 FOG0001583
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.800

Return to query results.
Submit another query.