DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8958 and Cnbd2

DIOPT Version :8

Sequence 1:NP_573105.1 Gene:CG8958 / 32575 FlyBaseID:FBgn0030725 Length:621 Species:Drosophila melanogaster
Sequence 2:NP_081861.2 Gene:Cnbd2 / 70873 MGIID:1918123 Length:673 Species:Mus musculus

Alignment Length:617 Identity:107/618 (17%)
Similarity:214/618 (35%) Gaps:200/618 (32%)


  Fly    35 WLSDEEEQGISMNVKKNVALMRQKRKPGMLTVADKALLRSNPAYRTIEERKKLCILIAGLNCFSR 99
            |  |:::||....|.::.|.......|..:::..|     .|::||.:|.:.||.::..|:|:..
Mouse   152 W--DKKKQGRISFVTEDFAAQEGHFPPRAISITQK-----KPSWRTHQEIQDLCNILQALDCYRS 209

  Fly   100 IPPKIRARMVPVLKFMSINEPRVIIKNGDMPISVYFILNGEVEMKKNTNNKAVKLEDAVAEAIFG 164
            ....::..:..|::|......|||:|.|.|..|.|||..|.|.:.::.:..:..|:.  ...:..
Mouse   210 YTESLQLLLAKVIRFERFGRRRVIVKKGQMGNSFYFIYLGTVAITEDEDGSSAFLDP--HPTLLH 272

  Fly   165 PGDCFGDVEMVEECPRMNTYLALSSCEVLSI-------------------YDIDYERILKPHMLK 210
            .|..||::.::....|..|.:.:...|.|.:                   |..::.|.|  .:.:
Mouse   273 RGGSFGEMGLLSTTVRSATVVCMEETEFLVVDREDFVANKLGDEVQKETQYRYNFFRNL--DIFQ 335

  Fly   211 QWNEKKL-------ALKAFDYFDFLTPDQIILACKYSYLVQYEPLETIYMGDTDSLGYVRFVLSG 268
            .|:|:||       .::.|.|...::.|                    :|..    .::.|:..|
Mouse   336 SWSEEKLWKLVALGRIERFSYGQMVSKD--------------------FMNS----AFITFICQG 376

  Fly   269 ECVILQCLSMKVTNTEGEVNYELTEINKDDGLEMFQSWKDVTSRNSFLDIQDILASSTSSEEVEG 333
            .|.||:.:::...:...:..::..|:.....|.:..:  :::.:..|.::|      ..|..::.
Mouse   377 NCEILRLVALGDCSAYYKWVWQQLELLDHKPLRIHDN--EISPKERFKELQ------IKSYPLQD 433

  Fly   334 GTKKKQAMRKMGLAEIQKFCGLRTSNTPSRKKTKPRRTLSTAAQARKTQLIQSLRRGTPWMPSVM 398
            .|..|       |..:||                          ||:.|                
Mouse   434 FTYLK-------LLRLQK--------------------------AREQQ---------------- 449

  Fly   399 PNDDDDDDDDDDGHIDEDYMGYGEDLYDEVDTDDSSYDSNSSSSSVSMDRTLVQVQLKPHSAGSS 463
                                  |.|.:.:::               .::.||.:: |.|      
Mouse   450 ----------------------GIDFHGKIN---------------KVENTLPKL-LGP------ 470

  Fly   464 PSEKKVSSSSSEIFTASSVINEKSLVDESPKPIKEPVETHFIDVGSLTYGSVFGLGEKMEHRVIM 528
                |:.|....: ...|::|.|  ..|.|   ||.:...::.:.....|.:.||     |:..:
Mouse   471 ----KIKSRFGHL-VKCSMVNTK--FGELP---KEAIVGVYMKIHKTEEGEIVGL-----HQAFV 520

  Fly   529 ARTVVQC---LLL-----------PRFWLLEEEQNPGNIWHRRRFYFECNVPSRQDLFTNFLKTR 579
            ......|   :||           .:|:.:.:|:....|     ...:.:.||.:||..:|||..
Mouse   521 PEIQRDCRPFILLSLGSELIQVRKEKFYDMVDEETRAKI-----IKMDVDYPSDEDLCQSFLKEN 580

  Fly   580 QWNKFRHDYIESLLDREEKGNI----TKEEDI 607
            .:..||.|.:..|::...|...    ||:::|
Mouse   581 DYIVFRKDLLRLLVEPLNKSPFIPVQTKKKEI 612

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8958NP_573105.1 Crp 97..>212 CDD:223736 25/134 (19%)
CAP_ED 97..207 CDD:237999 25/129 (19%)
Cnbd2NP_081861.2 Crp 200..>353 CDD:223736 31/157 (20%)
CAP_ED 211..308 CDD:237999 22/99 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C195225032
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T615180
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23011
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.990

Return to query results.
Submit another query.