DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8958 and Cnbd2

DIOPT Version :8

Sequence 1:NP_573105.1 Gene:CG8958 / 32575 FlyBaseID:FBgn0030725 Length:621 Species:Drosophila melanogaster
Sequence 2:NP_001291297.1 Gene:Cnbd2 / 296311 RGDID:1311678 Length:712 Species:Rattus norvegicus

Alignment Length:617 Identity:110/618 (18%)
Similarity:209/618 (34%) Gaps:199/618 (32%)


  Fly    35 WLSDEEEQG-ISMNVKKNVALMRQKRKPGMLTVADKALLRSNPAYRTIEERKKLCILIAGLNCFS 98
            |  |:::|| ||.:. ::.|.......|..:::..|     .|::||.||.:.||.::..|:|:.
  Rat   191 W--DKKKQGRISFDT-QDFAAEEGHFPPRAISITQK-----KPSWRTDEEIQDLCNILQVLDCYR 247

  Fly    99 RIPPKIRARMVPVLKFMSINEPRVIIKNGDMPISVYFILNGEVEMKKNTNNKAVKLEDAVAEAIF 163
            .....::..:..|::|......|||:|.|....|.|||..|.|.:.::.:..:..|:.  ...:.
  Rat   248 NYTEYLQLLLAKVMRFERFGRRRVIVKKGQRGNSFYFIYLGTVAVTEDEDGSSAFLDP--HPTLL 310

  Fly   164 GPGDCFGDVEMVEECPRMNTYLALSSCEVLSI-------------------YDIDYERILKPHML 209
            ..|..||::.::....|..|.:.:...|.|.:                   |..|:.|  |..|.
  Rat   311 HKGGFFGEMGLLSTAVRRATVVCMEETEFLVVDREDFLANKLGDEVQKETQYRYDFFR--KLDMF 373

  Fly   210 KQWNEKKL----ALKAFDYFDFLTPDQIILACKYSYLVQYEPLETIYMGDTDSLGYVRFVLSGEC 270
            :.|:::||    ||...:.|                     |...:...|..:..::.|:..|.|
  Rat   374 QSWSDEKLWQLVALGRIEKF---------------------PHGELVSKDIGNSAFITFICKGNC 417

  Fly   271 VILQCLSMKVTNTEGEVNYELTEINKDDGLEMFQSWKDVTSRNSFLDIQDILASSTSSEEVEGGT 335
            .||:.:.:....|.....::..|:.....|.:..:  :::.:..|.:.|      ..|..::..|
  Rat   418 EILRMVDLGTCRTYYRWVWQQLELLDHKPLRVHNN--EMSPKERFKEFQ------IKSYPLQDFT 474

  Fly   336 ----------KKKQAM---RKMGLAE--IQKFCGLRTSNTPSRKKTKPRRTLSTAAQARKTQLIQ 385
                      :::.||   ||:..||  :.|..|         .|.|.|...|.......|:   
  Rat   475 YLKLLRLQEAREQPAMTFHRKINKAENSLPKLLG---------PKVKSRYGHSVKCSMVHTK--- 527

  Fly   386 SLRRGTPWMPSVMPNDDDDDDDDDDGHIDEDYMGYGEDLYDEVDTDDSSYDSNSSSSSVSMDRTL 450
                                              ||| |..|                     .:
  Rat   528 ----------------------------------YGE-LPKE---------------------AI 536

  Fly   451 VQVQLKPHSAGSSPSEKKVSSSSSEIFTASSVINEKSLVDESPKPIKEPVETHFIDVGSLTYGSV 515
            |.|.:|.|           .:...::     |.|.::.:   |:..::|.....:.:|:      
  Rat   537 VGVYMKVH-----------LTEEGDV-----VGNHQAFL---PEIHRDPRSFILLSLGT------ 576

  Fly   516 FGLGEKMEHRVIMARTVVQCLLLPRFWLLEEEQNPGNIWHRRRFYFECNVPSRQDLFTNFLKTRQ 580
                     .:|..|.       .:|:.|.:.:....|     ...:.:.||.::|..:||....
  Rat   577 ---------ELIRVRK-------EKFYDLVDAETKAKI-----MKMDVDYPSDEELCQSFLSEND 620

  Fly   581 WNKFRHDYIESLLDREEKGNITKEEDIPIMCR 612
            |:.||.|.:..|::     .:.|:..|||..:
  Rat   621 WSIFRRDLLRLLVE-----PLKKKPFIPIQTK 647

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8958NP_573105.1 Crp 97..>212 CDD:223736 26/134 (19%)
CAP_ED 97..207 CDD:237999 25/129 (19%)
Cnbd2NP_001291297.1 CAP_ED 250..349 CDD:237999 21/101 (21%)
Crp 253..>348 CDD:223736 21/97 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1253607at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23011
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.