DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8939 and Mrm2

DIOPT Version :10

Sequence 1:NP_573099.1 Gene:CG8939 / 32568 FlyBaseID:FBgn0030720 Length:817 Species:Drosophila melanogaster
Sequence 2:NP_001100595.1 Gene:Mrm2 / 304323 RGDID:1305944 Length:246 Species:Rattus norvegicus


Alignment Length:200 Identity:71/200 - (35%)
Similarity:103/200 - (51%) Gaps:13/200 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KDKFYQLAKETGLRSRAAFKLIQLNRKFGFLQQSQVCLDLCAAPGGWMQVAKQNMPVS------- 69
            ||.|.:.||....|.|:||||:::|.|...|:.....||..||||.|.|||.|::..:       
  Rat    40 KDPFVKAAKAESYRCRSAFKLLEMNEKHHILRPGLRVLDCGAAPGAWSQVAVQSVNATGADSSSP 104

  Fly    70 -SIVIGVDLFPIRPIAGCIGLV-EDITTEKCRQSLTKELQSWKADVVLHDGAPNVG--RNWLYDA 130
             ..|:||||..:.|:||...|. .|:|..:..|.:.:.|...:|||:|.|.|||..  |:..:|.
  Rat   105 MGFVLGVDLLHMFPLAGATFLCPADVTDPRTFQRILELLPRRRADVILSDMAPNATGIRDLDHDR 169

  Fly   131 YQQICLTLNALKLSTQFLRNGGWFVTKVFRSKDYNALLWVLKQLFKKVHATKPSASRKESAEIFV 195
            ...:||||  :.::...|..||..:.|.:.....:.|...|.|.|:.....||.||||||||:::
  Rat   170 LISLCLTL--VDMAVDILHPGGTLLCKTWAGSKSHLLQKRLAQEFRSTRVVKPEASRKESAEVYL 232

  Fly   196 VCQGY 200
            :...|
  Rat   233 LATQY 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8939NP_573099.1 RlmE 1..200 CDD:440062 70/198 (35%)
DUF3381 233..366 CDD:463375
Spb1_C 610..803 CDD:462264
Mrm2NP_001100595.1 RlmE 25..239 CDD:440062 70/199 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.