DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exd and TGIF2LY

DIOPT Version :10

Sequence 1:NP_523360.1 Gene:exd / 32567 FlyBaseID:FBgn0000611 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_631960.1 Gene:TGIF2LY / 90655 HGNCID:18569 Length:185 Species:Homo sapiens


Alignment Length:102 Identity:27/102 - (26%)
Similarity:52/102 - (50%) Gaps:18/102 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 RRKRRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKR-------IRY 296
            ::::.|...::.:||.::.|.|....|||||.|:.|:.|..:::.::||||.|.|       ::.
Human    51 KKRKGNLPAESVKILRDWMYKHRFKAYPSEEEKQMLSEKTNLSLLRISNWFINARRRILPDMLQQ 115

  Fly   297 KKN-------IGKAQEEANLYAAKKAAGASPYSMAGP 326
            ::|       .||.....:|.:.:    ||..:.:||
Human   116 RRNDPIIGHKTGKDAHATHLQSTE----ASVPAKSGP 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exdNP_523360.1 PBC 42..237 CDD:461052
homeodomain 239..299 CDD:238039 19/66 (29%)
TGIF2LYNP_631960.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..58 1/6 (17%)
Homeobox_KN 69..107 CDD:428673 16/37 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 166..185
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.