DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exd and TGIF2

DIOPT Version :10

Sequence 1:NP_523360.1 Gene:exd / 32567 FlyBaseID:FBgn0000611 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_068581.1 Gene:TGIF2 / 60436 HGNCID:15764 Length:237 Species:Homo sapiens


Alignment Length:126 Identity:39/126 - (30%)
Similarity:65/126 - (51%) Gaps:13/126 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 LDARRKRR-NFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIRYKKN 299
            |..:|||| |..|::.:||.::.|.|..|.||||:.|..|:.:..::|.|:.|||.|.|.|...:
Human    15 LAGKRKRRGNLPKESVKILRDWLYLHRYNAYPSEQEKLSLSGQTNLSVLQICNWFINARRRLLPD 79

  Fly   300 -IGKAQEEANLYAAKKAAG-ASPYSMAGPPSGTTTPMMS---PAPPQ----DSMGYPMGSG 351
             :.|..::.|.:...:..| ||..::   |.|::..:::   |||..    .....|:.||
Human    80 MLRKDGKDPNQFTISRRGGKASDVAL---PRGSSPSVLAVSVPAPTNVLSLSVCSMPLHSG 137

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity