DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Or13a and Or33a

Sequence 1:NP_523359.2 Gene:Or13a FlyBaseID:FBgn0030715 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_523553.1 Gene:Or33a FlyBaseID:FBgn0026392 Length:378 Species:Drosophila melanogaster

Alignment Length:426 Identity:79/427 (19%)
Similarity:155/427 (36%) Gaps:98/427 (23%)


  Fly    29 ESSRPWRSQSLLATAYIVWAWYVIASVGITISYQTAFLLNNLSDIIITTENCCTTFMGVLNFVRL 93
            :|.|..||::|..|.::.|     ..:|:...|.    ...|.|..||            :|:.:
  Fly     2 DSRRKVRSENLYKTYWLYW-----RLLGVEGDYP----FRRLVDFTIT------------SFITI 45

  Fly    94 ---IHLRLNQRK------FRQLIENFSYEI-----------WIPNSSK----------NNVAAEC 128
               :||.|...|      ||.|  :|:.|.           |.....|          :.|.:|.
  Fly    46 LFPVHLILGMYKKPQIQVFRSL--HFTSECLFCSYKFFCFRWKLKEIKTIEGLLQDLDSRVESEE 108

  Fly   129 RR-----------RMVTFSIMTSLLACLIIMYCVLPLVEIFFGPAFDAQNKPFPYKMIFPYDAQS 182
            .|           ||::.|.:.:.::.:|    ...:..:|      :..:...|...||||.|:
  Fly   109 ERNYFNQNPSRVARMLSKSYLVAAISAII----TATVAGLF------STGRNLMYLGWFPYDFQA 163

  Fly   183 SWIRYVMTYIFTSYAGICVVTTLFAEDTILGFFITYTCGQFHLLHQRIAGLFAGSNAELAESIQL 247
            :...|.:::.:.:.....::....|.|:..........|...||..|::.:  |.:.:|:.|...
  Fly   164 TAAIYWISFSYQAIGSSLLILENLANDSYPPITFCVVSGHVRLLIMRLSRI--GHDVKLSSSENT 226

  Fly   248 ERLKRIVEKHNNIISFAKRLEDFFN-----PILLANLMISSVLICMVGFQIVTGKNMFIGDYVKF 307
            .:|...::.|..::...:.|....:     ..|.:.:.||..||.::.|    .:|.|...|  :
  Fly   227 RKLIEGIQDHRKLMKIIRLLRSTLHLSQLGQFLSSGINISITLINILFF----AENNFAMLY--Y 285

  Fly   308 IIYISSALSQLYVLCENGDALIKQSTLTAQILYECQWEGSDRIEIQSFTPTTKRIRNQIWFMILC 372
            .::.::.|.:|:..|..|..:..:.......::...|...|           ||....:..::..
  Fly   286 AVFFAAMLIELFPSCYYGILMTMEFDKLPYAIFSSNWLKMD-----------KRYNRSLIILMQL 339

  Fly   373 SQQPVRITAFKFSTLSLQSFTAILSTSISYFTLLRS 408
            :..||.|.|.....:.:.:|.|.:..:.|::||..|
  Fly   340 TLVPVNIKAGGIVGIDMSAFFATVRMAYSFYTLALS 375

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Or13aNP_523359.2 7tm_6 78..399 CDD:251636 62/367 (17%)
Or33aNP_523553.1 7tm_6 61..367 CDD:251636 57/337 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C51277
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21137
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.