| Sequence 1: | NP_523355.2 | Gene: | CycD / 32551 | FlyBaseID: | FBgn0010315 | Length: | 477 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_195831.1 | Gene: | CYCD7;1 / 831830 | AraportID: | AT5G02110 | Length: | 341 | Species: | Arabidopsis thaliana |
| Alignment Length: | 35 | Identity: | 10/35 - (28%) |
|---|---|---|---|
| Similarity: | 16/35 - (45%) | Gaps: | 0/35 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 65 FMNEPLSFLQRLSENVQYNYLLEKAAKCSDDMERI 99 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CycD | NP_523355.2 | CYCLIN_SF | 144..278 | CDD:477360 | |
| CYCLIN_CCND_rpt2 | 283..387 | CDD:410220 | |||
| CYCD7;1 | NP_195831.1 | CYCLIN_SF | 78..175 | CDD:477360 | |
| CYCLIN_AtCycD-like_rpt2 | 180..263 | CDD:410247 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||