DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: UBL3 and ATGP4

Sequence 1:NP_001162763.1 Gene:UBL3 FlyBaseID:FBgn0026076 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_001329044.1 Gene:ATGP4 AraportID:AT4G24990 Length:118 Species:Arabidopsis thaliana

Alignment Length:120 Identity:32/121 (26%)
Similarity:56/121 (46%) Gaps:12/121 (10%)


  Fly   234 DKINLRLILVSGK-TKEFIFSPSDSAGDIAQTVFDNWPEDWTHETVSKA-EILRLIYQGRFLHCN 296
            :.|:::..|..|. ...|.:|.:.:...:.|.|..:||:..|  .|.|. ..::||..|:.|..|
plant     5 ESIDIKFRLYDGSDIGPFRYSAASTVDFLKQRVVSDWPKGKT--VVPKGINEVKLISSGKILENN 67

  Fly   297 VTLGALGLPLGK----TTVMHLVPRDNLPEPNSQDQRQNSKGGSGRCCSTNCSIL 347
            .|:|....|.|.    ..|||:|.:.:|.:  |:.:::..|......|:  |:||
plant    68 KTVGQCKTPFGDIAGGVIVMHVVVQPSLAK--SKTEKKVDKAPKAVICT--CTIL 118

Known Domains:


GeneSequenceDomainRegion External IDIdentity
UBL3NP_001162763.1 Rad60-SLD_2 234..341 CDD:290592 29/113 (26%)
ATGP4NP_001329044.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR13169
Phylome 1 0.910 0.667 Consistency score
22.010

Return to query results.
Submit another query.