DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UBL3 and Ubl3

DIOPT Version :9

Sequence 1:NP_001162763.1 Gene:UBL3 / 32541 FlyBaseID:FBgn0026076 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_001346128.1 Gene:Ubl3 / 24109 MGIID:1344373 Length:117 Species:Mus musculus


Alignment Length:114 Identity:81/114 - (71%)
Similarity:88/114 - (77%) Gaps:0/114 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 MHRTIPSDKINLRLILVSGKTKEFIFSPSDSAGDIAQTVFDNWPEDWTHETVSKAEILRLIYQGR 291
            |...:|:|.|||||||||||||||:|||:|||.|||:.|:||||.||..|.||...|||||||||
Mouse     1 MSSHVPADMINLRLILVSGKTKEFLFSPNDSASDIAKHVYDNWPMDWEEEQVSSPNILRLIYQGR 65

  Fly   292 FLHCNVTLGALGLPLGKTTVMHLVPRDNLPEPNSQDQRQNSKGGSGRCC 340
            |||.|||||||.||.|||||||||.|:.|||||||.||...|.|...||
Mouse    66 FLHGNVTLGALKLPFGKTTVMHLVARETLPEPNSQGQRNREKTGESNCC 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UBL3NP_001162763.1 Rad60-SLD_2 234..341 CDD:290592 79/107 (74%)
Ubl3NP_001346128.1 Ubl_UBL3 10..91 CDD:340568 64/80 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 163 1.000 Domainoid score I3958
eggNOG 1 0.900 - - E1_2A8K3
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H5153
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006329
OrthoInspector 1 1.000 - - oto95408
orthoMCL 1 0.900 - - OOG6_104537
Panther 1 1.100 - - LDO PTHR13169
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4050
SonicParanoid 1 1.000 - - X4605
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.800

Return to query results.
Submit another query.