DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: UBL3 and Ubl3

Sequence 1:NP_001162763.1 Gene:UBL3 FlyBaseID:FBgn0026076 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_001346128.1 Gene:Ubl3 MGIID:1344373 Length:117 Species:Mus musculus

Alignment Length:114 Identity:81/115 (70%)
Similarity:88/115 (77%) Gaps:0/115 (0%)


  Fly   227 MHRTIPSDKINLRLILVSGKTKEFIFSPSDSAGDIAQTVFDNWPEDWTHETVSKAEILRLIYQGR 291
            |...:|:|.|||||||||||||||:|||:|||.|||:.|:||||.||..|.||...|||||||||
Mouse     1 MSSHVPADMINLRLILVSGKTKEFLFSPNDSASDIAKHVYDNWPMDWEEEQVSSPNILRLIYQGR 65

  Fly   292 FLHCNVTLGALGLPLGKTTVMHLVPRDNLPEPNSQDQRQNSKGGSGRCC 340
            |||.|||||||.||.|||||||||.|:.|||||||.||...|.|...||
Mouse    66 FLHGNVTLGALKLPFGKTTVMHLVARETLPEPNSQGQRNREKTGESNCC 114

Known Domains:


GeneSequenceDomainRegion External IDIdentity
UBL3NP_001162763.1 Rad60-SLD_2 234..341 CDD:290592 79/108 (73%)
Ubl3NP_001346128.1 Ubl_UBL3 10..91 CDD:340568 64/81 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2A8K3
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H5153
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005211
OrthoInspector 1 1.000 T1085208
orthoMCL 1 0.900 OOG5_133277
Panther 1 1.100 LDO PTHR13169
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4050
TreeFam 1 0.960
98.800

Return to query results.
Submit another query.