DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: UBL3 and ubl3

Sequence 1:NP_001162763.1 Gene:UBL3 FlyBaseID:FBgn0026076 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_001107740.1 Gene:ubl3 XenbaseID:XB-GENE-951598 Length:117 Species:Xenopus tropicalis

Alignment Length:114 Identity:81/115 (70%)
Similarity:90/115 (78%) Gaps:0/115 (0%)


  Fly   227 MHRTIPSDKINLRLILVSGKTKEFIFSPSDSAGDIAQTVFDNWPEDWTHETVSKAEILRLIYQGR 291
            |..::|:|.|||||||||||||||::||:|||.|||:.|:||||.||..|.||...|||||||||
 Frog     1 MSSSVPADMINLRLILVSGKTKEFLYSPNDSAADIAKHVYDNWPMDWEEEQVSSPNILRLIYQGR 65

  Fly   292 FLHCNVTLGALGLPLGKTTVMHLVPRDNLPEPNSQDQRQNSKGGSGRCC 340
            |||.|||||||.||||||||||||.|:.|||||||.||...|.|...||
 Frog    66 FLHGNVTLGALKLPLGKTTVMHLVARETLPEPNSQGQRNREKTGESNCC 114

Known Domains:


GeneSequenceDomainRegion External IDIdentity
UBL3NP_001162763.1 Rad60-SLD_2 234..341 CDD:290592 79/108 (73%)
ubl3NP_001107740.1 Rad60-SLD_2 8..114 CDD:290592 78/106 (74%)
UBQ 10..88 CDD:214563 62/78 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2A8K3
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H5153
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005211
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.770

Return to query results.
Submit another query.