DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ArgRS and MSR1

Sequence 1:NP_573081.1 Gene:ArgRS FlyBaseID:FBgn0027093 Length:665 Species:Drosophila melanogaster
Sequence 2:NP_011959.1 Gene:MSR1 SGDID:S000001133 Length:643 Species:Saccharomyces cerevisiae

Alignment Length:576 Identity:160/577 (28%)
Similarity:252/577 (44%) Gaps:112/577 (19%)


  Fly   143 ATELKGH------CPASPIIEKLEIAGAGFVNVFLSKDYASLALSNLLRNGVKPPEVI------- 194
            |.||..|      |...|           |:..||.:.|       |:::.|  |.::       
Yeast   127 AIELSTHGCIGKVCAKGP-----------FLQFFLDQRY-------LIQSTV--PNILLQKGKYG 171

  Fly   195 ------KKRVLVDFSSPNIAKQMHVGHLRSTIIGESLCRLLEFLQHDVIRINHLGDWGTQFGMLI 253
                  :|:|:|:||||||||..|.|||||||||..|..|.|.:...|.|:|:|||||.|||:|.
Yeast   172 QKKSRHQKKVVVEFSSPNIAKPFHAGHLRSTIIGGFLSNLYEAMGWSVTRMNYLGDWGRQFGLLA 236

  Fly   254 AHLEDRFPNYLNE----SPPISDLQLFYKESKKRFDEDE-------EFKKRAYSRVVSLQKGVPN 307
            .    .|..|.:|    ..||..|...|.:......::|       .....|.|...:|:.|..|
Yeast   237 V----GFKRYGDEKTLQKQPIQHLFDVYVKINMDLAKEEINGNSKCGISGEARSFFKNLENGDEN 297

  Fly   308 SIKAWELICNVSRKEFQTIYERLDISVK-ERGES-FYQSRMLSVVEYLRGKGLLEVDEGREIM-- 368
            :||.|....::|...:...|.||:|:.. ..||| ..:..|...::..|...|::..:|..::  
Yeast   298 AIKIWNRFRSLSIHHYIQTYSRLNINFDIFSGESQVSKESMNEALDIFRKNNLVKEIDGALVIDL 362

  Fly   369 --WPDDTKTGIPLTIVKSDGGFTYDTSDMAAIRHRLEEELCDWIIYVVDSGQSTHFNTIFKAAER 431
              |   :|....:.:.||||...|.|.|:.|...|.:....|.::||:.|.|..:.:..|     
Yeast   363 TQW---SKRLGRVVVQKSDGTTLYLTRDVGAAIERKKNLHFDKMVYVISSQQDLYMSQFF----- 419

  Fly   432 SAILNPLSHR----VDHVQFGVVLGEDGKKFKTRSGDTVKLSDLLDEGMKRSLQQLESRGR--DK 490
             .||..::..    :.|:.||:|.|     ..||.|:.|.|..:|||...::||.:|:...  .:
Yeast   420 -MILKKMNFEWAKDLQHINFGMVQG-----MSTRKGNVVFLDTILDEARDKALQIMENNKMKISQ 478

  Fly   491 VLTPQELKDAQESLAYGCIKYSDLCHNRISDYIFSFDKMLEDRGNTAVYLLYTYTRICSIARNSG 555
            |..||.:.|.   :....|...|:...||::|.|::::||...|:|..||.||::|:.|:.|.|.
Yeast   479 VDNPQRVADL---IGVSAIIIQDMKSKRINNYEFNWNRMLSFEGDTGPYLQYTHSRLRSLERTSS 540

  Fly   556 E---------DFTNL--PEILKKTNIVLDHEKEWKLAKTLLKLHDILIKCSKELFLHFLCEFCFE 609
            :         ||:||  |:::             :|.:.|.:..|:|.:..:......:..:.|:
Yeast   541 DFTTDMLIHADFSNLNEPQLV-------------ELVRLLAQYPDVLRRAFETQEPATIVTYLFK 592

  Fly   610 VCTVFTEFYDSCYCIEKNKQGDIIGVNHSRILLCEATAAVLRQCFYILGLKPVSKM 665
            ||...:..|...:.  ..|..||.   ..|:.:..|:..||.....:|||.||.:|
Yeast   593 VCHQVSSCYKKIWV--SGKPADIA---IPRLAVYSASRQVLHNAMSLLGLVPVDRM 643

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ArgRSNP_573081.1 Arg_tRNA_synt_N 81..171 CDD:214975 8/34 (24%)
PLN02286 83..665 CDD:215160 159/575 (28%)
ArgRS_core 197..463 CDD:185675 89/287 (31%)
DALR_1 540..665 CDD:214846 32/136 (24%)
MSR1NP_011959.1 argS 69..643 CDD:273085 159/575 (28%)
Arg_tRNA_synt_N 73..150 CDD:281483 8/34 (24%)
ArgRS_core 180..449 CDD:185675 89/287 (31%)
Anticodon_Ia_Arg 487..643 CDD:153410 44/177 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C289562285
eggNOG 1 0.900 E1_COG0018
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126752
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1455
TreeFam 00.000 Not matched by this tool.
43.760

Return to query results.
Submit another query.