DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ArgRS and YDR341C

Sequence 1:NP_573081.1 Gene:ArgRS FlyBaseID:FBgn0027093 Length:665 Species:Drosophila melanogaster
Sequence 2:NP_010628.3 Gene:YDR341C SGDID:S000002749 Length:607 Species:Saccharomyces cerevisiae

Alignment Length:680 Identity:194/681 (28%)
Similarity:293/681 (43%) Gaps:142/681 (21%)


  Fly    50 NRLFILKK-SIAEESTAAGGDVSKPKESS---SITEHLESVFRQAIASAFPEFRDTPVIIAPVNS 110
            |.:..||| ||||.:.|        |:|.   :|.:.:.:...|.::.           |:.|:|
Yeast     6 NMISQLKKLSIAEPAVA--------KDSHPDVNIVDLMRNYISQELSK-----------ISGVDS 51

  Fly   111 TSAKFGDYQCNNAMGLS------KKLKEKGINKAPRDIATELKGHCPASPIIEKLEIAGAGFVNV 169
             |..|...:..|.|...      .:|:.||.|  |:|:|.:.....|....:||:| |...|:..
Yeast    52 -SLIFPALEWTNTMERGDLLIPIPRLRIKGAN--PKDLAVQWAEKFPCGDFLEKVE-ANGPFIQF 112

  Fly   170 FLSKDY-ASLALSNLLR-----NGVKPPEVIKKRVLVDFSSPNIAKQMHVGHLRSTIIGESLCRL 228
            |.:..: |.|.:.::|.     ...|..|  .|:|:::||||||||..|.|||||||||..|..|
Yeast   113 FFNPQFLAKLVIPDILTRKEDYGSCKLVE--NKKVIIEFSSPNIAKPFHAGHLRSTIIGGFLANL 175

  Fly   229 LEFLQHDVIRINHLGDWGTQFGMLIAHLEDRFPNYLNE----SPPISDLQLFYKESKKRFDEDEE 289
            .|.|..:|||:|:|||||.|||:|..    .|..|.||    ..||..|...|....|..:|:.:
Yeast   176 YEKLGWEVIRMNYLGDWGKQFGLLAV----GFERYGNEEALVKDPIHHLFDVYVRINKDIEEEGD 236

  Fly   290 F---------KKRAYSRVVSLQKGVPNSIKAWELICNVSRKEFQTIYERLDISVK-ERGES-FYQ 343
            .         |.|.|.:  .::.|...::|.|:.....|.:::...|.||:|... ..||| ..:
Yeast   237 SIPLEQSTNGKAREYFK--RMEDGDEEALKIWKRFREFSIEKYIDTYARLNIKYDVYSGESQVSK 299

  Fly   344 SRMLSVVEYLRGKGLLEVDEGREIMWPDDTKTGIPL---TIVKSDGGFTYDTSDMAAIRHRLEEE 405
            ..||..::..:.|||...|:|..::  |.||....|   .:.||||...|.|.|:.|...|.|:.
Yeast   300 ESMLKAIDLFKEKGLTHEDKGAVLI--DLTKFNKKLGKAIVQKSDGTTLYLTRDVGAAMDRYEKY 362

  Fly   406 LCDWIIYVVDSGQSTHFNTIFKAAERSAILNPLSHR----VDHVQFGVVLGEDGKKFKTRSGDTV 466
            ..|.:|||:.|.|..|      ||:...||..:...    :.||.||:|.|     ..||.|..|
Yeast   363 HFDKMIYVIASQQDLH------AAQFFEILKQMGFEWAKDLQHVNFGMVQG-----MSTRKGTVV 416

  Fly   467 KLSDLLDEGMKRSLQQLESRGRDKVLTPQELKDAQESLAYGCIKYSDLCHNRISDYIFSFDKMLE 531
            .|.::|:| .|..:.::..:..:|....:..::..:.:....:...|:...||::|.|.:::||.
Yeast   417 FLDNILEE-TKEKMHEVMKKNENKYAQIEHPEEVADLVGISAVMIQDMQGKRINNYEFKWERMLS 480

  Fly   532 DRGNTAVYLLYTYTRICSIARNS---------GEDFTNLPEILKKTNIVLDHEKEWKLAKTLLKL 587
            ..|:|..||.|.::|:.|:.||:         ..||:.|.|               ..||.|::|
Yeast   481 FEGDTGPYLQYAHSRLRSVERNASGITQEKWINADFSLLKE---------------PAAKLLIRL 530

  Fly   588 ----HDILIKCSKELFLHFLCEFCFEVCTVFTEFY------DSCYCIEKNKQGDIIGV------- 635
                .|:|....|          ..|..||.|..:      .|||        |::.|       
Yeast   531 LGQYPDVLRNAIK----------THEPTTVVTYLFKLTHQVSSCY--------DVLWVAGQTEEL 577

  Fly   636 NHSRILLCEATAAVLRQCFYILGLKPVSKM 665
            ..:|:.|..|...||.....:|||.||.:|
Yeast   578 ATARLALYGAARQVLYNGMRLLGLTPVERM 607

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ArgRSNP_573081.1 Arg_tRNA_synt_N 81..171 CDD:214975 22/96 (23%)
PLN02286 83..665 CDD:215160 181/642 (28%)
ArgRS_core 197..463 CDD:185675 100/288 (35%)
DALR_1 540..665 CDD:214846 36/151 (24%)
YDR341CNP_010628.3 argS 31..607 CDD:273085 182/646 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C289550651
eggNOG 1 0.900 E1_COG0018
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126752
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1455
TreeFam 00.000 Not matched by this tool.
43.760

Return to query results.
Submit another query.