DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ArgRS and emb1027

Sequence 1:NP_573081.1 Gene:ArgRS FlyBaseID:FBgn0027093 Length:665 Species:Drosophila melanogaster
Sequence 2:NP_001329503.1 Gene:emb1027 AraportID:AT4G26300 Length:653 Species:Arabidopsis thaliana

Alignment Length:600 Identity:280/600 (47%)
Similarity:387/600 (65%) Gaps:27/600 (5%)


  Fly    76 SSSITEHLESVFRQAIASAFPEFRDTPVIIAPVNSTSA--KFGDYQCNNAMGLSKKLKEKGIN-K 137
            :.::...|..:|..::....|   |.| .:.|:.:.||  |||||||||||||...:|.||.. |
plant    71 TGNLKRQLAKLFDVSLKLTVP---DEP-SVEPLVAASALGKFGDYQCNNAMGLWSIIKGKGTQFK 131

  Fly   138 APRDIATELKGHCPASPIIEKLEIAGAGFVNVFLSKDYASLALSNLLRNGVK--PPEVIKKRVLV 200
            .|..:...|....|.|.::|...:||.||:||.||..:.:.::.|:|.:||.  .|.:..||.:|
plant   132 GPPAVGQALVKSLPTSEMVESCSVAGPGFINVVLSAKWMAKSIENMLIDGVDTWAPTLSVKRAVV 196

  Fly   201 DFSSPNIAKQMHVGHLRSTIIGESLCRLLEFLQHDVIRINHLGDWGTQFGMLIAHLEDRFP--NY 263
            |||||||||:||||||||||||::|.|:||:...:|:|.||:|||||||||||.:|.::||  :.
plant   197 DFSSPNIAKEMHVGHLRSTIIGDTLARMLEYSHVEVLRRNHVGDWGTQFGMLIEYLFEKFPDTDS 261

  Fly   264 LNESPPISDLQLFYKESKKRFDEDEEFKKRAYSRVVSLQKGVPNSIKAWELICNVSRKEFQTIYE 328
            :.|: .|.|||:|||.||.:||.||.||::|...||.||.|.|...|||..||::||.||..:|:
plant   262 VTET-AIGDLQVFYKASKHKFDLDEAFKEKAQQAVVRLQGGDPVYRKAWAKICDISRTEFAKVYQ 325

  Fly   329 RLDISVKERGESFYQSRMLSVVEYLRGKGLLEVDEGREIMWPDDTKTGIPLTIVKSDGGFTYDTS 393
            ||.:.::|:|||||...:..|:|.|..|||:|..||..:::.:.  ..|||.:|||||||.|.::
plant   326 RLRVELEEKGESFYNPHIAKVIEELNSKGLVEESEGARVIFLEG--FDIPLMVVKSDGGFNYAST 388

  Fly   394 DMAAIRHRLEEELCDWIIYVVDSGQSTHFNTIFKAAERSAIL--NPLSH-RVDHVQFGVVLGEDG 455
            |:.|:.:||.||..:|||||.|.||..|||..||||.::..|  |..:: ||:||.||:||||||
plant   389 DLTALWYRLNEEKAEWIIYVTDVGQQQHFNMFFKAARKAGWLPDNDKTYPRVNHVGFGLVLGEDG 453

  Fly   456 KKFKTRSGDTVKLSDLLDEGMKRSLQQLESRGRDKVLTPQELKDAQESLAYGCIKYSDLCHNRIS 520
            |:|:||:.|.|:|.|||||...||...|..||:||..||:||....|::.||.:||:||.:||::
plant   454 KRFRTRATDVVRLVDLLDEAKTRSKLALIERGKDKEWTPEELDQTAEAVGYGAVKYADLKNNRLT 518

  Fly   521 DYIFSFDKMLEDRGNTAVYLLYTYTRICSIARNSGEDFTNLPEILKKTNIVLDHEKEWKLAKTLL 585
            :|.||||:||.|:|||||||||.:.|||||.|.||:|   :.|:.|...:.|||..|..|...||
plant   519 NYTFSFDQMLNDKGNTAVYLLYAHARICSIIRKSGKD---IDELKKTGKLALDHADERALGLHLL 580

  Fly   586 KLHDILIKCSKELFLHFLCEFCFEVCTVFTEFYDSCYCIEKNKQGDIIGVNHSRILLCEATAAVL 650
            :..:.:.:....|....|||:.:.:...||.||.:|   :.|...:    ..||:|||||||.|:
plant   581 RFAETVEEACTNLLPSVLCEYLYNLSEHFTRFYSNC---QVNGSPE----ETSRLLLCEATAIVM 638

  Fly   651 RQCFYILGLKPVSKM 665
            |:||::||:.||.|:
plant   639 RKCFHLLGITPVYKI 653

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ArgRSNP_573081.1 Arg_tRNA_synt_N 81..171 CDD:214975 36/93 (39%)
PLN02286 83..665 CDD:215160 280/592 (47%)
ArgRS_core 197..463 CDD:185675 145/271 (54%)
DALR_1 540..665 CDD:214846 49/125 (39%)
emb1027NP_001329503.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H68281
Inparanoid 1 1.050 508 1.000 Inparanoid score I299
OMA 1 1.010
OrthoDB 1 1.010 D463402at2759
OrthoInspector 1 1.000 T125194
orthoMCL 1 0.900 OOG5_126752
Panther 1 1.100 LDO PTHR11956
Phylome 1 0.910 0.667 Consistency score
98.980

Return to query results.
Submit another query.