DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ArgRS and RARS

Sequence 1:NP_573081.1 Gene:ArgRS FlyBaseID:FBgn0027093 Length:665 Species:Drosophila melanogaster
Sequence 2:NP_002878.2 Gene:RARS HGNCID:9870 Length:660 Species:Homo sapiens

Alignment Length:670 Identity:383/671 (57%)
Similarity:488/671 (73%) Gaps:19/671 (3%)


  Fly     1 MSELNMELKKLRELELKTQGLAARIQTAKSGEQLDV--DLVQLQIENKKLKNRLFILKKSIAEES 63
            :||.:..|.: :|.|:|:  |.|.|...|:...|..  :|.|||.||.|||.||.||:||:..|.
Human     5 VSECSARLLQ-QEEEIKS--LTAEIDRLKNCGCLGASPNLEQLQEENLKLKYRLNILRKSLQAER 66

  Fly    64 TAAGGDVSKP-KESSSITEHLESVFRQAIASAFPEFRDTPVIIAPVNSTSAKFGDYQCNNAMGLS 127
                   :|| |...:|...|:.||..||.:|:|:..:.|:::.|  |..|||||||||:|||:|
Human    67 -------NKPTKNMINIISRLQEVFGHAIKAAYPDLENPPLLVTP--SQQAKFGDYQCNSAMGIS 122

  Fly   128 KKLKEKGINKAPRDIATELKGHCPASPIIEKLEIAGAGFVNVFLSKDYASLALSNLLRNGVKPPE 192
            :.||.|.....||:||..:..|.|.:..|||:||||.||:||.|.||:.|..|::||.|||:.|.
Human   123 QMLKTKEQKVNPREIAENITKHLPDNECIEKVEIAGPGFINVHLRKDFVSEQLTSLLVNGVQLPA 187

  Fly   193 V-IKKRVLVDFSSPNIAKQMHVGHLRSTIIGESLCRLLEFLQHDVIRINHLGDWGTQFGMLIAHL 256
            : ..|:|:||||||||||:||||||||||||||:.||.||..:||:|:||:||||||||||||||
Human   188 LGENKKVIVDFSSPNIAKEMHVGHLRSTIIGESISRLFEFAGYDVLRLNHVGDWGTQFGMLIAHL 252

  Fly   257 EDRFPNYLNESPPISDLQLFYKESKKRFDEDEEFKKRAYSRVVSLQKGVPNSIKAWELICNVSRK 321
            :|:||:||..||||.|||:||||||||||.:||||||||..||.||...|:..|||:|||:|||:
Human   253 QDKFPDYLTVSPPIGDLQVFYKESKKRFDTEEEFKKRAYQCVVLLQGKNPDITKAWKLICDVSRQ 317

  Fly   322 EFQTIYERLDISVKERGESFYQSRMLSVVEYLRGKGLLEVDEGREIMWPDDTKTGIPLTIVKSDG 386
            |...||:.||:|:.||||||||.||..:|:....:|.::||:||:|::...  ..||||||||||
Human   318 ELNKIYDALDVSLIERGESFYQDRMNDIVKEFEDRGFVQVDDGRKIVFVPG--CSIPLTIVKSDG 380

  Fly   387 GFTYDTSDMAAIRHRLEEELCDWIIYVVDSGQSTHFNTIFKAAERSAILNPLSHRVDHVQFGVVL 451
            |:||||||:|||:.||.||..|.||||||:|||.||.|||.||:.....:|...||.|..|||||
Human   381 GYTYDTSDLAAIKQRLFEEKADMIIYVVDNGQSVHFQTIFAAAQMIGWYDPKVTRVFHAGFGVVL 445

  Fly   452 GEDGKKFKTRSGDTVKLSDLLDEGMKRSLQQLESRGRDKVLTPQELKDAQESLAYGCIKYSDLCH 516
            |||.||||||||:||:|.|||.||:|||:.:|:.:.||||||.:||..||.|:|||||||:||.|
Human   446 GEDKKKFKTRSGETVRLMDLLGEGLKRSMDKLKEKERDKVLTAEELNAAQTSVAYGCIKYADLSH 510

  Fly   517 NRISDYIFSFDKMLEDRGNTAVYLLYTYTRICSIARNSGEDFTNLPEILKKTNIVLDHEKEWKLA 581
            ||::||||||||||:||||||.||||.:|||.||||.:..|...|.:..::|.|:|||||||||.
Human   511 NRLNDYIFSFDKMLDDRGNTAAYLLYAFTRIRSIARLANIDEEMLQKAARETKILLDHEKEWKLG 575

  Fly   582 KTLLKLHDILIKCSKELFLHFLCEFCFEVCTVFTEFYDSCYCIEKNKQ-GDIIGVNHSRILLCEA 645
            :.:|:..:||.|...:||||.||::.:|:.|.||||||||||:||::| |.|:.||..|:|||||
Human   576 RCILRFPEILQKILDDLFLHTLCDYIYELATAFTEFYDSCYCVEKDRQTGKILKVNMWRMLLCEA 640

  Fly   646 TAAVLRQCFYILGLKPVSKM 665
            .|||:.:.|.|||:|||.:|
Human   641 VAAVMAKGFDILGIKPVQRM 660

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ArgRSNP_573081.1 Arg_tRNA_synt_N 81..171 CDD:214975 43/90 (48%)
PLN02286 83..665 CDD:215160 351/584 (60%)
ArgRS_core 197..463 CDD:185675 175/266 (66%)
DALR_1 540..665 CDD:214846 68/126 (54%)
RARSNP_002878.2 Could be involved in the assembly of the multisynthetase complex 1..72 30/77 (39%)
tRNA-synt_1d 80..660 CDD:332079 351/584 (60%)
L-arginine binding. {ECO:0000244|PDB:4Q2T, ECO:0000269|PubMed:24859084} 200..202 2/2 (100%)
'HIGH' region 201..212 10/11 (91%)
Interaction with tRNA. {ECO:0000250|UniProtKB:Q05506} 529..543 10/14 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C289513840
eggNOG 1 0.900 E1_COG0018
Hieranoid 1 1.000
Homologene 1 1.000 H68281
Inparanoid 1 1.050 715 1.000 Inparanoid score I630
Isobase 1 0.950 0 Normalized mean entropy S1498
OMA 1 1.010
OrthoDB 1 1.010 D463402at2759
OrthoFinder 1 1.000 FOG0006369
OrthoInspector 1 1.000 T1075100
orthoMCL 1 0.900 OOG5_126752
Panther 1 1.100 LDO PTHR11956
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.720

Return to query results.
Submit another query.