DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ArgRS and dalrd3

Sequence 1:NP_573081.1 Gene:ArgRS FlyBaseID:FBgn0027093 Length:665 Species:Drosophila melanogaster
Sequence 2:NP_001116798.1 Gene:dalrd3 ZFINID:ZDB-GENE-061103-415 Length:558 Species:Danio rerio

Alignment Length:686 Identity:121/687 (18%)
Similarity:223/687 (32%) Gaps:238/687 (35%)


  Fly    46 KKLKNRLFILKKSIAEESTAAGGDVSKPKESSSITEHLESVFRQAIASAFPEFRDTPVIIAPVNS 110
            |.|:||.|:...::. .:..|||:|  |.:               :.||....|.:.|:  |:.:
Zfish    45 KNLRNRDFLAPNTVL-TTLYAGGEV--PSD---------------VLSAVRALRGSGVL--PIGA 89

  Fly   111 TS-------------AKFGDYQCNNAMGLSKKLKEKGINKAPRDIATELKG----HCPASPIIEK 158
            |.             |.|....|    |:...||.          |.:.:|    :|||....:.
Zfish    90 TEVTTEGLRVCVDRCAAFRGVLC----GIMPYLKP----------AAQRQGCVLINCPALHTKQS 140

  Fly   159 LEIAGAGFVNVFLSKDYASLALSNLLRNGVKPPEVIKKRVLVDFSSPNIAKQMHVG-HLRSTIIG 222
            :.           |.|  :|||..|            :.:|:         ..|:| .||.....
Zfish   141 VP-----------SPD--TLALGQL------------RTILI---------ADHLGAQLRRQGYT 171

  Fly   223 ESLCRLLEFLQHDVIR-INHLG-DWGTQFGMLIAHLEDRFPNYLNESPPISDLQLFYKESKKRFD 285
            .|.|..|. .:.|::. :..|| ||.|                    .|:|           ..:
Zfish   172 VSFCPALP-QESDIVNFLKTLGIDWPT--------------------VPVS-----------WTN 204

  Fly   286 EDEEFKKRAYSRVVSLQKGVPNSIKAWELICNVSRKEFQTIYERLDISVKERGESFYQSRMLSVV 350
            ||.|.|         ::|.:.||          :.::.:|          |:|:.          
Zfish   205 EDREEK---------MKKALENS----------AYRDRET----------EKGKR---------- 230

  Fly   351 EYLRGKGLLEVDEGREIMWPDDTKTGIPLTIVKSDGGFTYD------TSDMAAIRH--RLEEELC 407
               |.:|  |..||.:....:|.:..:. .:|:.:....||      |....|:.|  :|:....
Zfish   231 ---RSRG--EEIEGEKRGLKEDVRINLK-QVVQDENLNGYDPSLGTCTVQREALCHLAQLDSATA 289

  Fly   408 DW------IIYVV---DSGQSTHFNTIFKAA-----ERSAILNPLSHRVDHVQFGVVLGEDGKKF 458
            |:      .::|.   |..:......:::||     :|..|..|:  :...||.........:|.
Zfish   290 DFPASTTTALHVTSCQDEFRQQQTAMLWRAAGATALQRLVICGPV--KTPGVQMNAAQYFQLRKA 352

  Fly   459 KTRSGDTVKLSDLLDEGMKRSLQQLESRGRDKVLTPQELKDAQESLAYGCIKYSDLCHNRISDYI 523
            :.:....:|..|           |:|.:..|.::         ..:....:::..|.....|...
Zfish   353 QMKEASEMKYGD-----------QVEGQTWDDII---------RVMTSATVRFELLSTVHTSPVT 397

  Fly   524 FSF--DKMLEDRG-NTAVYLLYTYTRICSI--ARNSGEDFTNLPEILKKTNI---VLDHEKEWKL 580
            ...  |..:..:| ...|:::|...|:.::  :...|.:....|||...|.:   .|..|.||.|
Zfish   398 LDVQRDSGVSTKGPRGGVFVMYNCARLHTLFSSYEKGVEQGLYPEIPGGTELDFSALKEEGEWLL 462

  Fly   581 A-KTLLKLHDILIKCSK-----------ELFLHFLCEFCFEVCTVFTEFYDSCYCIEKNKQGD-- 631
            . ..|:...:||.:.::           :|....:|.|...:...|:.:|:..:.:     |:  
Zfish   463 LFNYLIPFSEILDQSAQTLEHEGGGARVQLRTEQVCRFLVSLSKDFSSYYNRVHVL-----GEPL 522

  Fly   632 --IIGVNHSRILLCEATAAVLRQCFYILGLKPVSKM 665
              :......|:||..|...:.......|.|.|:.::
Zfish   523 PHLFNQMFCRLLLLRALRELYHSALDSLNLPPIPQL 558

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ArgRSNP_573081.1 Arg_tRNA_synt_N 81..171 CDD:214975 17/107 (16%)
PLN02286 83..665 CDD:215160 111/648 (17%)
ArgRS_core 197..463 CDD:185675 50/291 (17%)
DALR_1 540..665 CDD:214846 28/146 (19%)
dalrd3NP_001116798.1 DALR_1 417..>528 CDD:214846 21/116 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0018
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.