DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ArgRS and DALRD3

Sequence 1:NP_573081.1 Gene:ArgRS FlyBaseID:FBgn0027093 Length:665 Species:Drosophila melanogaster
Sequence 2:XP_005265326.1 Gene:DALRD3 HGNCID:25536 Length:575 Species:Homo sapiens

Alignment Length:675 Identity:128/676 (19%)
Similarity:220/676 (33%) Gaps:224/676 (33%)


  Fly    80 TEHLESVFRQAIASAFPEFRDTPVIIAPVNSTSAKFGDYQ----------CNNAMGLSKKLKEKG 134
            |.||.|             ||   .:||..:..|:|.|.|          |....|::..|:   
Human    32 TRHLRS-------------RD---FLAPHRALQARFDDGQVPEHLLHALACLQGPGVAPVLR--- 77

  Fly   135 INKAPRDIATELKGHCPASPIIEKLEIAGAGFVNVFLSKDYASLALSNLLRNGVKPPEVIKKRVL 199
            ....|..::.:|:    .|.:.|::..|.|.         ||:.|          .|..:.:|||
Human    78 CAPTPAGLSLQLQ----RSAVFERVLSAVAA---------YATPA----------SPASLGQRVL 119

  Fly   200 VDF----SSPNIAKQMHVGHLRSTIIGESLCRLLEFLQHDV-IRINHLGDWGTQFGMLIAHLEDR 259
            :..    |||   ..:.:..||:.::.:.|.|.|.  .|.| :|             |:..:.| 
Human   120 LHCPALRSSP---CALRLSQLRTVLVADHLARALR--AHGVCVR-------------LVPAVRD- 165

  Fly   260 FPNYLNESPPISDLQLFYKESKKRFDEDEEFKKRAYSRVVSLQKGVPNSIKAWELICNVSRKEFQ 324
             |:.|..   :..|::.:..:.:| ......:..|...:.|...|...|......:|   .||. 
Human   166 -PHMLTF---LQQLRVDWPAASER-ASSHTLRSHALEELTSANDGRTLSPGILGRLC---LKEL- 221

  Fly   325 TIYERLDISVKERGES----------FYQSRMLSVVEYLRGKGLLEVDEGREIMWPDDTKTGIPL 379
                     |:|:|.:          .....:|||        |.|:.|.. ..||:|:..|:..
Human   222 ---------VEEQGRTAGYDPNLDNCLVTEDLLSV--------LAELQEAL-WHWPEDSHPGLAG 268

  Fly   380 TIVKSDGGFTYDTSDMAAIRHRLEEELCDWIIYVV---DSGQSTHFNTIFKAAERSAILNPLSHR 441
            ......||                   | .:::||   :..|....:.:::.....|   ||  |
Human   269 ASDTGTGG-------------------C-LVVHVVSCEEEFQQQKLDLLWQKLVDKA---PL--R 308

  Fly   442 VDHVQFG--VVLGEDG------KKFKTRSGDTVKLSDLLDEGMKRSLQQLESRGRDKVLTP--QE 496
            ..|:..|  .|.|..|      :.::.|.....|.|.|             ..|.|....|  .|
Human   309 QKHLICGPVKVAGAPGTLMTAPEYYEFRHTQVCKASAL-------------KHGGDLAQDPAWTE 360

  Fly   497 LKDAQESLAYGCIKYSDLCHNRISDYIFSF-DKMLEDRG-NTAVYLLYTYTRI--------CSIA 551
            :...   |:...||:..|.....|....:. |..:..:| .:..:::|...|:        ||:.
Human   361 IFGV---LSVATIKFEMLSTAPQSQLFLALADSSISTKGTKSGTFVMYNCARLATLFESYKCSME 422

  Fly   552 RNSGEDFTNLPEILKKTNIVLDHEKEWKLA-KTLLKLHDIL-----IKCSKELFLH------FLC 604
            :..   :...|.:......:|..|.||.|. .::|...|:|     :.|:.. .||      .:|
Human   423 QGL---YPTFPPVSSLDFSLLHDEGEWLLLFNSILPFPDLLSRTAVLDCTAP-GLHIAVRTEMIC 483

  Fly   605 EFCFEVCTVFTEFYDSCYCI----EKNKQG---------------------------DIIGVNHS 638
            :|..::...|:.:|:..:.:    ::|..|                           .:.|....
Human   484 KFLVQLSMDFSSYYNRVHILGVSTQQNGVGRAERYRVKAKEAEDETSRPFLFQEPRPHLFGQMFV 548

  Fly   639 RILLCEATAAVLRQCFYILGLKPVS 663
            |:.|..|...||.....:|||.|:|
Human   549 RLQLLRAVREVLHTGLAMLGLPPLS 573

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ArgRSNP_573081.1 Arg_tRNA_synt_N 81..171 CDD:214975 20/100 (20%)
PLN02286 83..665 CDD:215160 126/673 (19%)
ArgRS_core 197..463 CDD:185675 56/292 (19%)
DALR_1 540..665 CDD:214846 33/176 (19%)
DALRD3XP_005265326.1 DALR_1 403..575 CDD:214846 33/176 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0018
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.