DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ArgRS and Rars

Sequence 1:NP_573081.1 Gene:ArgRS FlyBaseID:FBgn0027093 Length:665 Species:Drosophila melanogaster
Sequence 2:NP_001099247.2 Gene:Rars RGDID:1309215 Length:660 Species:Rattus norvegicus

Alignment Length:661 Identity:369/662 (56%)
Similarity:484/662 (73%) Gaps:16/662 (2%)


  Fly    10 KLRELELKTQGLAARIQTAKSGEQLDV--DLVQLQIENKKLKNRLFILKKSIAEESTAAGGDVSK 72
            :|.:.|.:.:.|.|.|...|:...|:.  .|.||:.||.|||.||.||::|:..|.       .:
  Rat    11 RLLQQEKEIKSLTAEIDRLKNCSYLEASPSLEQLREENLKLKYRLNILRRSLQAER-------KR 68

  Fly    73 P-KESSSITEHLESVFRQAIASAFPEFRDTPVIIAPVNSTSAKFGDYQCNNAMGLSKKLKEKGIN 136
            | |...:|...|:.:|..||.:|:|:..:.|:::.|  |...||||||||:|||:|:.||.|...
  Rat    69 PTKNMININSRLQELFGCAIKAAYPDLENPPLVVTP--SQQPKFGDYQCNSAMGISQMLKAKEQK 131

  Fly   137 KAPRDIATELKGHCPASPIIEKLEIAGAGFVNVFLSKDYASLALSNLLRNGVKPPEV-IKKRVLV 200
            .:||:||..:..|.|.:..|:::||||.||:||.|.||:.|..|:|||.|||:.|.: ..::|:|
  Rat   132 VSPREIAENITKHLPNNEYIDRVEIAGPGFINVHLRKDFVSEQLTNLLVNGVQLPVLGENEKVIV 196

  Fly   201 DFSSPNIAKQMHVGHLRSTIIGESLCRLLEFLQHDVIRINHLGDWGTQFGMLIAHLEDRFPNYLN 265
            |||||||||:||||||||||||||:.||.||..::|:|:||:||||||||||||||:|:||:||.
  Rat   197 DFSSPNIAKEMHVGHLRSTIIGESMSRLFEFAGYNVLRLNHVGDWGTQFGMLIAHLQDKFPDYLT 261

  Fly   266 ESPPISDLQLFYKESKKRFDEDEEFKKRAYSRVVSLQKGVPNSIKAWELICNVSRKEFQTIYERL 330
            .||||.|||.||||||||||.:||||||||..||.||...|:.:|||.|||:|||:||..||:.|
  Rat   262 VSPPIGDLQAFYKESKKRFDTEEEFKKRAYECVVLLQSKNPDIMKAWNLICDVSREEFNKIYDAL 326

  Fly   331 DISVKERGESFYQSRMLSVVEYLRGKGLLEVDEGREIMWPDDTKTGIPLTIVKSDGGFTYDTSDM 395
            ||::.||||||||.||..:|:....||.::||:||:|::...  ..:||||||||||:||||||:
  Rat   327 DITLIERGESFYQDRMKDIVKEFEDKGFVQVDDGRKIVFVPG--CSVPLTIVKSDGGYTYDTSDL 389

  Fly   396 AAIRHRLEEELCDWIIYVVDSGQSTHFNTIFKAAERSAILNPLSHRVDHVQFGVVLGEDGKKFKT 460
            |||:.||.||..:.||||||:||:|||.|:|.||:.....:|...||.||.||||||||.|||||
  Rat   390 AAIKQRLFEEKANKIIYVVDNGQATHFQTVFAAAQMIGWYDPKVTRVAHVGFGVVLGEDKKKFKT 454

  Fly   461 RSGDTVKLSDLLDEGMKRSLQQLESRGRDKVLTPQELKDAQESLAYGCIKYSDLCHNRISDYIFS 525
            |||:||:|.|||:||::||:.:|:.:.||||||.:|||.||.|:|||||||:||.|||::||:||
  Rat   455 RSGETVRLMDLLEEGLRRSMDKLKEKERDKVLTEEELKAAQTSVAYGCIKYADLSHNRLNDYVFS 519

  Fly   526 FDKMLEDRGNTAVYLLYTYTRICSIARNSGEDFTNLPEILKKTNIVLDHEKEWKLAKTLLKLHDI 590
            |||||:||||||.||||.:|||.||||.:..|...|....::|.|:|||||||||.:.:|:..:|
  Rat   520 FDKMLDDRGNTAAYLLYAFTRIRSIARLANIDEEMLQRAARETKIILDHEKEWKLGRCILRFPEI 584

  Fly   591 LIKCSKELFLHFLCEFCFEVCTVFTEFYDSCYCIEKNKQ-GDIIGVNHSRILLCEATAAVLRQCF 654
            |.|...:||||.||::.:|:.|.||||||||||:||::| |.::.||..|:|||||.|||:.:.|
  Rat   585 LQKILDDLFLHTLCDYIYELATTFTEFYDSCYCVEKDRQTGKVLKVNMWRMLLCEAVAAVMAKGF 649

  Fly   655 YILGLKPVSKM 665
            .|||:|||.:|
  Rat   650 DILGIKPVQRM 660

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ArgRSNP_573081.1 Arg_tRNA_synt_N 81..171 CDD:214975 39/90 (43%)
PLN02286 83..665 CDD:215160 344/584 (59%)
ArgRS_core 197..463 CDD:185675 174/266 (65%)
DALR_1 540..665 CDD:214846 67/126 (53%)
RarsNP_001099247.2 Could be involved in the assembly of the multisynthetase complex. {ECO:0000250} 1..72 23/68 (34%)
Arg_tRNA_synt_N 79..166 CDD:214975 39/89 (44%)
PLN02286 80..660 CDD:215160 344/584 (59%)
ArgRS_core 193..457 CDD:185675 174/266 (65%)
L-arginine binding. {ECO:0000250|UniProtKB:P54136} 200..202 2/2 (100%)
'HIGH' region. {ECO:0000250} 201..212 10/11 (91%)
Anticodon_Ia_like 498..660 CDD:299868 95/162 (59%)
Interaction with tRNA. {ECO:0000250|UniProtKB:Q05506} 529..543 10/14 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C289513489
eggNOG 1 0.900 E1_COG0018
Hieranoid 1 1.000
Homologene 1 1.000 H68281
Inparanoid 1 1.050 711 1.000 Inparanoid score I602
OMA 1 1.010
OrthoDB 1 1.010 D463402at2759
OrthoFinder 1 1.000 FOG0006369
OrthoInspector 1 1.000 T1088756
orthoMCL 1 0.900 OOG5_126752
Panther 1 1.100 LDO PTHR11956
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1312.770

Return to query results.
Submit another query.