DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ArgRS and mrs1

Sequence 1:NP_573081.1 Gene:ArgRS FlyBaseID:FBgn0027093 Length:665 Species:Drosophila melanogaster
Sequence 2:NP_596077.1 Gene:mrs1 PomBaseID:SPBC25B2.09c Length:618 Species:Schizosaccharomyces pombe

Alignment Length:636 Identity:169/637 (27%)
Similarity:278/637 (44%) Gaps:108/637 (17%)


  Fly    86 VFRQAIASAFPEFRDTPV-IIAPVNSTSAKFGDYQCN------NAMGLSKKLKEKGINKAPRDIA 143
            |:|..|:|...:.....| :|.|...||........|      ...|..::|.:|.....|:|: 
pombe    35 VYRSYISSELSKINGVDVSLIYPALETSISKDSADLNLPVPRLRVKGKPQELAQKWAEAFPKDL- 98

  Fly   144 TELKGHCPASPIIEKLEIAGAGFVNVFLSKDYASLALSNLLRNGVKPPEVIKKR----------- 197
                           :|:...|   :||..::...:|:.|:.     |.:.::|           
pombe    99 ---------------VEVTANG---IFLRFNFNGPSLTKLIL-----PIIWEQRENYGRNESGSG 140

  Fly   198 --VLVDFSSPNIAKQMHVGHLRSTIIGESLCRLLEFLQHDVIRINHLGDWGTQFGMLIAHL---- 256
              .:::||||||||..|.|||||||||..|..|.|.....|.|:|:|||||.|||:|....    
pombe   141 KVAVIEFSSPNIAKPFHAGHLRSTIIGSFLANLHESQGWKVHRVNYLGDWGKQFGLLAIGYKKYG 205

  Fly   257 -EDRFPNYLNESPPISDL-QLFYKESKKRFDEDEEFKKRAYSRVVSLQKGVP------------- 306
             ||:.     :|.||..| .::.|.:....:|||:.:|   .:..:..||:|             
pombe   206 DEDQL-----KSNPIRHLYDVYVKVNADATEEDEKIQK---DKAEAESKGLPYTPPLSLHDKARE 262

  Fly   307 ----------NSIKAWELICNVSRKEFQTIYERLDISVKE-RGESFYQSRMLS-VVEYLRGKGLL 359
                      .|:|.|....::|..:.:..|:||:|...| .|||.....::: :|:.||...|:
pombe   263 FFKRMEDGDEESLKVWARFRDLSITKLKDTYDRLNIHYDEYDGESQVSLELMNKMVDELRSLNLI 327

  Fly   360 EVDEGREI--MWPDDTKTGIPLTIVKSDGGFTYDTSDMAAIRHRLEEELCDWIIYVVDSGQSTHF 422
            |.|.|..:  :...|.|.|..: :.|.||...|.|.|:.....|.|:...|..||||.|.|..:|
pombe   328 EEDGGALLIDLSKHDKKLGKAI-VQKRDGTTLYLTRDIGTAYKRYEKYKFDKSIYVVSSQQDMYF 391

  Fly   423 NTIFKAAERSAILNPLSHRVDHVQFGVVLGEDGKKFKTRSGDTVKLSDLLD---EGMKRSLQQLE 484
            :.:||..|....  ..:.:..|:.:|:|.|     ..||.|..|.|.|:::   |.|.:.:|:.|
pombe   392 SQLFKIFELMGF--DWAKKCVHINYGLVQG-----MSTRKGKAVFLDDIMEVAKEEMHKVMQKNE 449

  Fly   485 SRGRDKVLTPQELKDAQESLAYGCIKYSDLCHNRISDYIFSFDKMLEDRGNTAVYLLYTYTRICS 549
            .: ..:|..|:|:.|.....|   |:..|....||::|.|.:.:|....|:|..||.|.::|:.|
pombe   450 EK-YAQVENPEEVADIVGKTA---IRIQDSTGKRINNYAFDWSRMTSFEGDTGPYLQYAHSRLSS 510

  Fly   550 IARNSGEDFTNLPEILKKTNIVLDHEKEWKLAKTLLKLHDILIKCSKELFLHFLCEFCFEVCTVF 614
            :.||  .::|: .||:.....:|.....:.|.:.|.:..|:|....:......:..:.|::....
pombe   511 VRRN--VNYTD-EEIMGANLELLTEPDAYDLVRLLGQYPDVLKNAFRFQETSTVVTYLFKLTHAV 572

  Fly   615 TEFYDSCYCIEKNKQGDIIGVNHSRILLCEATAAVLRQCFYILGLKPVSKM 665
            ::.||..:.  :.::.||   ..:|:.|..|...||.....:|||.|:.:|
pombe   573 SKLYDILWV--RGRERDI---QLARLALFGAAKQVLNNGMTLLGLTPLERM 618

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ArgRSNP_573081.1 Arg_tRNA_synt_N 81..171 CDD:214975 18/92 (20%)
PLN02286 83..665 CDD:215160 168/635 (26%)
ArgRS_core 197..463 CDD:185675 95/312 (30%)
DALR_1 540..665 CDD:214846 28/125 (22%)
mrs1NP_596077.1 ArgS 30..618 CDD:223097 168/635 (26%)
Arg_tRNA_synt_N 34..112 CDD:214975 19/96 (20%)
ArgRS_core 144..425 CDD:185675 94/297 (32%)
Anticodon_Ia_Arg 463..618 CDD:153410 40/166 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126752
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1455
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.