DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ArgRS and rars-1

Sequence 1:NP_573081.1 Gene:ArgRS FlyBaseID:FBgn0027093 Length:665 Species:Drosophila melanogaster
Sequence 2:NP_001022551.1 Gene:rars-1 WormBaseID:WBGene00004679 Length:713 Species:Caenorhabditis elegans

Alignment Length:699 Identity:339/700 (48%)
Similarity:464/700 (66%) Gaps:62/700 (9%)


  Fly    21 LAARIQTAKSGEQLDVDLVQLQIE-------NKKLKNRLFILKKSIAEE---------------- 62
            |..|:.||....:|..:|::...|       |.|||.|..||:|||||:                
 Worm    23 LLNRLITAMQKGELTDELLEHIPELGDAKKLNDKLKYRKSILEKSIAEQAAKNKKNGVKATSTSS 87

  Fly    63 ---STAA------------GGDVSKPKES------------SSITEHLESVFRQAIASAFPEFRD 100
               ||:|            ||  :.||::            |||...|:|:|::||..|||.. |
 Worm    88 PSSSTSAPAEKKAKKDGKTGG--APPKQAKKVDYVTVEDYGSSIFGRLQSLFKKAIEDAFPGL-D 149

  Fly   101 TPVIIAPVNSTSAKFGDYQCNNAMGLSKKLKEKGINKAPRDIATELKGHCPAS-PIIEKLEIAGA 164
            .|:::|  .:.:.:|||||||:||.::.|||...|||.|.|:|.|::...|.. ..:||:::..|
 Worm   150 VPLLLA--ETPNPQFGDYQCNSAMPIAAKLKANKINKRPGDVAKEIQAKLPTKIDFVEKIDVMPA 212

  Fly   165 GFVNVFLSKDYASLALSNLLRNGVKPPEVIKKRVLVDFSSPNIAKQMHVGHLRSTIIGESLCRLL 229
            ||:|:||:.||....:|.|...|||.|::.:||||||||||||||:||||||||||||:|:|||.
 Worm   213 GFINIFLNTDYLRRQISLLASEGVKLPKLTRKRVLVDFSSPNIAKEMHVGHLRSTIIGDSICRLF 277

  Fly   230 EFLQHDVIRINHLGDWGTQFGMLIAHLEDRFPNYLNESPPISDLQLFYKESKKRFDEDEEFKKRA 294
            |.:..||:|:||:||||||||||||||.||||::|.:.|.|||||.|||||||||||||:|||||
 Worm   278 EAVGFDVLRVNHIGDWGTQFGMLIAHLYDRFPDFLKKLPDISDLQAFYKESKKRFDEDEQFKKRA 342

  Fly   295 YSRVVSLQKGVPNSIKAWELICNVSRKEFQTIYERLDISVKERGESFYQSRMLSVVEYLRGK--G 357
            |..||.||....:.:|||..||:||:|..|.:|..|||.:|:.||||||.:|:.:|::::..  .
 Worm   343 YEYVVKLQSHDGDIVKAWNTICDVSKKYNQIVYNYLDIKIKDVGESFYQDKMIELVKWVKTNKPD 407

  Fly   358 LLEVDEGREIMWPDDTKTGIPLTIVKSDGGFTYDTSDMAAIRHRLEEELCDWIIYVVDSGQSTHF 422
            :|..::||:||:|  |...||||:|||||||||||||:||:::|:.||.|||.|||||||||.|.
 Worm   408 MLREEDGRQIMFP--TGCDIPLTVVKSDGGFTYDTSDLAALKYRMLEEKCDWNIYVVDSGQSLHL 470

  Fly   423 NTIFKAAERSAILNPLSHRVDHVQFGVVLGEDGKKFKTRSGDTVKLSDLLDEGMKRSLQQLESRG 487
            .|::.|.......:....||:||.||:|||:|.||||||||:||:|.|||.||:||:.::|..:|
 Worm   471 ETVYAAGRDFGWYDESIQRVEHVAFGLVLGDDKKKFKTRSGETVRLLDLLSEGVKRATEKLIEKG 535

  Fly   488 RDKVLTPQELKDAQESLAYGCIKYSDLCHNRISDYIFSFDKMLEDRGNTAVYLLYTYTRICSIAR 552
            |:..::.::|..|::::|:||:||:||.|.|..||:||||:||||||||||||||.||||.||..
 Worm   536 RETAMSEEQLVAARDAVAFGCVKYADLSHTRTQDYVFSFDRMLEDRGNTAVYLLYAYTRIQSIFE 600

  Fly   553 NSGEDFTNLPEILKKT-NIVLDHEKEWKLAKTLLKLHDILIKCSKELFLHFLCEFCFEVCTVFTE 616
            .......:|.:.:..| .:.|||..|:||||.||||.|.::.....|.||.:|::.:::.|:|.:
 Worm   601 KDEVKNVDLVKYIASTPTLPLDHPGEFKLAKQLLKLSDCVLLVLDSLMLHQMCDYVYQLATLFHD 665

  Fly   617 FYDSCYCIEKNKQGDIIGVNHSRILLCEATAAVLRQCFYILGLKPVSKM 665
            ||:.||.|| ||:|:...|:..|:.||:.|..|:..||.||||:.|:||
 Worm   666 FYNECYVIE-NKEGEKPFVHMHRLALCDVTRKVMSTCFKILGLREVNKM 713

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ArgRSNP_573081.1 Arg_tRNA_synt_N 81..171 CDD:214975 38/91 (42%)
PLN02286 83..665 CDD:215160 309/586 (53%)
ArgRS_core 197..463 CDD:185675 166/268 (62%)
DALR_1 540..665 CDD:214846 53/126 (42%)
rars-1NP_001022551.1 Arg_tRNA_synt_N 132..219 CDD:214975 38/90 (42%)
PLN02286 133..713 CDD:215160 309/586 (53%)
ArgRS_core 245..511 CDD:185675 166/268 (62%)
Anticodon_Ia_like 550..713 CDD:299868 79/164 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C289521565
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 1 1.000 H68281
Inparanoid 1 1.050 622 1.000 Inparanoid score I475
Isobase 1 0.950 0 Normalized mean entropy S1498
OMA 1 1.010
OrthoDB 1 1.010 D463402at2759
OrthoFinder 1 1.000 FOG0006369
OrthoInspector 1 1.000 T476844
orthoMCL 1 0.900 OOG5_126752
Panther 1 1.100 LDO PTHR11956
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1455
TreeFam 00.000 Not matched by this tool.
1312.890

Return to query results.
Submit another query.