DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ArgRS and Rars2

Sequence 1:NP_573081.1 Gene:ArgRS FlyBaseID:FBgn0027093 Length:665 Species:Drosophila melanogaster
Sequence 2:NP_852071.2 Gene:Rars2 MGIID:1923596 Length:578 Species:Mus musculus

Alignment Length:617 Identity:184/618 (30%)
Similarity:301/618 (49%) Gaps:81/618 (13%)


  Fly    87 FRQAIASAF-------PEFRDTPVIIAPVNSTSAKFGDYQCNNAMGLSKKLKEKGINKAPRDIAT 144
            ||::||...       ||.....:...|| |...:..|:|.:     ...|.|...:|:..|...
Mouse     5 FRRSIACQLSRVLALPPESLIKSISAVPV-SKKEEVADFQLS-----VDSLLEDNNHKSQVDTQD 63

  Fly   145 ELKGHCPASPIIEKLEI--------AGAGFVNVFLSKDYASLA-LSNLLRNGVKP-------PEV 193
            :      |..:.|||:.        ||...:|..::::..:.| |..:..:|.|.       .::
Mouse    64 Q------ARRLAEKLKCDTVVTAISAGPRTLNFKINRELLTKAVLQQVTEDGCKYGLKSELFSDL 122

  Fly   194 IKKRVLVDFSSPNIAKQMHVGHLRSTIIGESLCRLLEFLQHDVIRINHLGDWGTQFGML-----I 253
            .|||::|:||||||||:.|||||||||||..:..|.|.|.|.|.|||::||||.|||:|     :
Mouse   123 PKKRIVVEFSSPNIAKKFHVGHLRSTIIGNFIANLKEALGHQVTRINYIGDWGMQFGLLGTGFQL 187

  Fly   254 AHLEDRFPNYLNESPPISDLQLFYKESKKRFDEDEEFKKRAYSRVVSLQKGVPNSIKAWELICNV 318
            ...|::.     ::.|:..|...|.:..|...:|:...|.|:.....|:.|...::..|:...::
Mouse   188 FGYEEKL-----QTNPLQHLFDVYVQVNKEATDDKNVTKLAHEFFHRLEMGDTQALSLWQRFRDL 247

  Fly   319 SRKEFQTIYERLDISVKE-RGESFYQSRMLSVVEYLRGKGLLE-VDEGREIMWPDDTKTG---IP 378
            |.:|:..||:||.|...| .|||||:.:...|::.|..||||: ..||..::  |.:.||   ..
Mouse   248 SIEEYTQIYKRLGIYFDEYSGESFYREKSQDVLKLLDSKGLLQKTAEGNVVV--DLSGTGDLSSV 310

  Fly   379 LTIVKSDGGFTYDTSDMAAIRHRLEEELCDWIIYVVDSGQSTHFNTIFKAAERSAILN-PLSHRV 442
            .|:::|||...|.|.|:||..||:::...|.:|||.|.||..||..:|:..:   |:. ..:.|.
Mouse   311 CTVMRSDGTSLYATRDLAAAIHRMDKYNFDTMIYVADKGQRRHFQQVFQMLK---IMGYDWAERC 372

  Fly   443 DHVQFGVVLGEDGKKFKTRSGDTVKLSDLLDEGMKRSLQQLESRGRDKVLTPQELKDAQES---L 504
            .||.||:|.|     .|||.|....|.|:|:|...|.||.:.|     :.|.::|::.||:   :
Mouse   373 QHVPFGIVKG-----MKTRRGGVTFLEDVLNEVQSRMLQNMAS-----IKTTKQLENPQETAERV 427

  Fly   505 AYGCIKYSDLCHNRISDYIFSFDKMLEDRGNTAVYLLYTYTRICSIARNSGEDFTNLPEILKKTN 569
            ....:...|.....:|||.||:|::.:.||:|.|:|.||:.|:||:....|..:.|      .:|
Mouse   428 GLAAVIIQDFRGTLLSDYQFSWDRVFQSRGDTGVFLQYTHARLCSLEETFGCGYLN------DSN 486

  Fly   570 IV-LDHEKEWKLAKTLLKLHDILIKCSKELFLHFLCEFCFEVCTVFTEFYDSCYCIEKNKQGDII 633
            :. |...:...:.:.||:..::|...|::|....:..:...:..:....:.:...  |:...|:.
Mouse   487 VACLQEPQSVSILQHLLRFDEVLYLSSQDLQPKHIVSYLLTLSHLAAVAHKTLQV--KDSPPDVA 549

  Fly   634 GVNHSRILLCEATAAVLRQCFYILGLKPVSKM 665
            |   :|:.|.:|..:||.....:||:.||.:|
Mouse   550 G---ARLHLFKAVRSVLANGMKLLGITPVCRM 578

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ArgRSNP_573081.1 Arg_tRNA_synt_N 81..171 CDD:214975 22/99 (22%)
PLN02286 83..665 CDD:215160 183/616 (30%)
ArgRS_core 197..463 CDD:185675 104/277 (38%)
DALR_1 540..665 CDD:214846 27/126 (21%)
Rars2NP_852071.2 ArgS 30..578 CDD:223097 177/591 (30%)
ArgRS_core 126..388 CDD:185675 104/277 (38%)
'HIGH' region 133..144 9/11 (82%)
L-arginine binding. {ECO:0000250|UniProtKB:P54136} 133..135 2/2 (100%)
Anticodon_Ia_like 425..578 CDD:299868 38/164 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0018
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126752
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1455
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.