DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ArgRS and Rars

Sequence 1:NP_573081.1 Gene:ArgRS FlyBaseID:FBgn0027093 Length:665 Species:Drosophila melanogaster
Sequence 2:NP_080212.2 Gene:Rars MGIID:1914297 Length:660 Species:Mus musculus

Alignment Length:661 Identity:377/662 (57%)
Similarity:485/662 (73%) Gaps:16/662 (2%)


  Fly    10 KLRELELKTQGLAARIQTAKSGEQLDV--DLVQLQIENKKLKNRLFILKKSIAEESTAAGGDVSK 72
            :|.:.|.:.:.|.|.|...|:...|:.  .|.||:.||.|||.||.||::|:.||.       .|
Mouse    11 RLLQQEREIKALTAEIDRLKNCGCLEASPSLEQLREENLKLKYRLNILRRSLQEER-------RK 68

  Fly    73 P-KESSSITEHLESVFRQAIASAFPEFRDTPVIIAPVNSTSAKFGDYQCNNAMGLSKKLKEKGIN 136
            | |...:|...|:.||..||.:|:|:..:.|:|:.|  |...||||||||:|||:|:.||.|...
Mouse    69 PTKNMININSRLQEVFGCAIRAAYPDLENPPLIVTP--SQQPKFGDYQCNSAMGISQMLKAKEQK 131

  Fly   137 KAPRDIATELKGHCPASPIIEKLEIAGAGFVNVFLSKDYASLALSNLLRNGVKPPEV-IKKRVLV 200
            .:||:||..:..|.|.:..|:|:||||.||:||.|.||:.|..|::||.|||:.|.: .|::|:|
Mouse   132 VSPREIAENITKHLPNNKYIDKVEIAGPGFINVHLRKDFVSEQLTSLLVNGVQLPVLGDKEKVIV 196

  Fly   201 DFSSPNIAKQMHVGHLRSTIIGESLCRLLEFLQHDVIRINHLGDWGTQFGMLIAHLEDRFPNYLN 265
            |||||||||:||||||||||||||:.||.||..:||:|:||:||||||||||||||:|:||:||.
Mouse   197 DFSSPNIAKEMHVGHLRSTIIGESMSRLFEFAGYDVLRLNHVGDWGTQFGMLIAHLQDKFPDYLT 261

  Fly   266 ESPPISDLQLFYKESKKRFDEDEEFKKRAYSRVVSLQKGVPNSIKAWELICNVSRKEFQTIYERL 330
            .||||.|||.||||||||||.|||||||||..||.||...|:.:|||.|||:|||:||:.||:.|
Mouse   262 VSPPIGDLQAFYKESKKRFDADEEFKKRAYQCVVLLQSKNPDIMKAWNLICDVSREEFKKIYDAL 326

  Fly   331 DISVKERGESFYQSRMLSVVEYLRGKGLLEVDEGREIMWPDDTKTGIPLTIVKSDGGFTYDTSDM 395
            ||::.||||||||.||..:|:....||.::||:||:|::...  ..:||||||||||:||||||:
Mouse   327 DITLIERGESFYQDRMKDIVKEFEDKGFVQVDDGRKIVFVPG--CSVPLTIVKSDGGYTYDTSDL 389

  Fly   396 AAIRHRLEEELCDWIIYVVDSGQSTHFNTIFKAAERSAILNPLSHRVDHVQFGVVLGEDGKKFKT 460
            |||:.||.||..:.||||||:||:.||.|||.||:.....:|....|.||.||||||||.|||||
Mouse   390 AAIKQRLFEEKANKIIYVVDNGQAIHFQTIFAAAQMIGWYDPKVTLVTHVGFGVVLGEDKKKFKT 454

  Fly   461 RSGDTVKLSDLLDEGMKRSLQQLESRGRDKVLTPQELKDAQESLAYGCIKYSDLCHNRISDYIFS 525
            |||:||:|.|||:||:|||:.:|:.:.||||||.:|||.||.|:|||||||:||.|||::|||||
Mouse   455 RSGETVRLMDLLEEGLKRSMDKLKEKERDKVLTEEELKAAQTSVAYGCIKYADLSHNRLNDYIFS 519

  Fly   526 FDKMLEDRGNTAVYLLYTYTRICSIARNSGEDFTNLPEILKKTNIVLDHEKEWKLAKTLLKLHDI 590
            |||||:||||||.||||.:|||.||||.:..|...|....::|.|:|||||||||.:.:|:..:|
Mouse   520 FDKMLDDRGNTAAYLLYAFTRIRSIARLANIDEAMLQRAARETKIILDHEKEWKLGRCILRFPEI 584

  Fly   591 LIKCSKELFLHFLCEFCFEVCTVFTEFYDSCYCIEKNKQ-GDIIGVNHSRILLCEATAAVLRQCF 654
            |.|...:||||.||::.:|:.|.||||||||||:||::| |.::.||..|:|||||.|||:.:.|
Mouse   585 LQKILDDLFLHTLCDYIYELATTFTEFYDSCYCVEKDRQTGKVLKVNMWRMLLCEAVAAVMAKGF 649

  Fly   655 YILGLKPVSKM 665
            .|||:|||.:|
Mouse   650 DILGIKPVQRM 660

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ArgRSNP_573081.1 Arg_tRNA_synt_N 81..171 CDD:214975 42/90 (47%)
PLN02286 83..665 CDD:215160 350/584 (60%)
ArgRS_core 197..463 CDD:185675 175/266 (66%)
DALR_1 540..665 CDD:214846 67/126 (53%)
RarsNP_080212.2 Could be involved in the assembly of the multisynthetase complex 1..72 25/68 (37%)
Arg_tRNA_synt_N 79..166 CDD:214975 42/89 (47%)
PLN02286 80..660 CDD:215160 350/584 (60%)
ArgRS_core 193..457 CDD:185675 175/266 (66%)
L-arginine binding. {ECO:0000250|UniProtKB:P54136} 200..202 2/2 (100%)
'HIGH' region 201..212 10/11 (91%)
Anticodon_Ia_like 498..660 CDD:299868 96/162 (59%)
Interaction with tRNA. {ECO:0000250|UniProtKB:Q05506} 529..543 10/14 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C289513948
eggNOG 1 0.900 E1_COG0018
Hieranoid 1 1.000
Homologene 1 1.000 H68281
Inparanoid 1 1.050 716 1.000 Inparanoid score I629
Isobase 1 0.950 0 Normalized mean entropy S1498
OMA 1 1.010
OrthoDB 1 1.010 D463402at2759
OrthoFinder 1 1.000 FOG0006369
OrthoInspector 1 1.000 T1085206
orthoMCL 1 0.900 OOG5_126752
Panther 1 1.100 LDO PTHR11956
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1455
TreeFam 1 0.960
1514.750

Return to query results.
Submit another query.