DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8509 and RRD2

Sequence 1:NP_573079.1 Gene:CG8509 FlyBaseID:FBgn0030696 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_015173.1 Gene:RRD2 SGDID:S000006073 Length:358 Species:Saccharomyces cerevisiae

Alignment Length:387 Identity:96/388 (25%)
Similarity:172/388 (44%) Gaps:60/388 (15%)


  Fly    27 PVKQVRSLEDLDRWVRSQAYYDIIAYISNTSKAIQGHRLTQ-TFPVTE----QMRRLSEIFDGLD 86
            |.|::.:.:|:..|..|........:|.:.:::::||..:| ..|::|    .|..||:|.|   
Yeast     3 PEKRLLTPDDMKLWEESPTRAHFTKFIIDLAESVKGHENSQYKEPISESINSMMNLLSQIKD--- 64

  Fly    87 HLIVEHTPKIEDSYLALPFGQVRSKAYRTWMREMYQHVFSKLDEAI------NVNCKHINELGQY 145
              |.:..|.|:|:. :..||:|.       .|:.|..| |:....|      ::..:.:.:|..|
Yeast    65 --ITQKHPVIKDAD-SSRFGKVE-------FRDFYDEV-SRNSRKILRSEFPSLTDEQLEQLSIY 118

  Fly   146 LRRSFGNGNTLDFGPANELMFLFFLCGLFRAGIL-LAKDTVAAALMLFNRYVNVVRRLISTYGLT 209
            |..|:||...:|:|..:||.|:..|.||:..||. |:.|:....|.:|..|:.::|.|.:.|.| 
Yeast   119 LDESWGNKRRIDYGSGHELNFMCLLYGLYSYGIFNLSNDSTNLVLKVFIEYLKIMRILETKYWL- 182

  Fly   210 IAKDPACT-----IEDYYFLPYLWGAAQLSVDSPFSPMQCEQGKIMDNYRQDFMMLEIIDHLQKT 269
               :||.:     ::||:|||:|:||.||:......|:.....::::.:...::....|..:.|.
Yeast   183 ---EPAGSHGVWGLDDYHFLPFLFGAFQLTTHKHLKPISIHNNELVEMFAHRYLYFGCIAFINKV 244

  Fly   270 RSGPLSRVALQLW------SILSIPTWPQVYRGLERNYIDHVLSSFGTVEQAIFCELMSF-EAVV 327
            :|....|     |      .|..:.||.:|..|:.:.|...|||....::...|.|.:.. :.|.
Yeast   245 KSSASLR-----WHSPMLDDISGVKTWSKVAEGMIKMYKAEVLSKLPIMQHFYFSEFLPCPDGVS 304

  Fly   328 PIMPLQRAHLGTHLIVDEKENEDELEQKYGENRWSLSPPVSRYVSMEPESFLGFQASKTHNK 389
            |  |....|.||     :|::|...| .:....|.....:..     |.:....:.:|.|:|
Yeast   305 P--PRGHIHDGT-----DKDDECNFE-GHVHTTWGDCCGIKL-----PSAIAATEMNKKHHK 353

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8509NP_573079.1 PTPA 27..324 CDD:281137 82/321 (26%)
RRD2NP_015173.1 LAG1 1..358 CDD:227390 96/388 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5057
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S1048
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002142
OrthoInspector 1 1.000 T634851
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10012
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.920

Return to query results.
Submit another query.