DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8509 and RRD1

Sequence 1:NP_573079.1 Gene:CG8509 FlyBaseID:FBgn0030696 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_012113.1 Gene:RRD1 SGDID:S000001415 Length:393 Species:Saccharomyces cerevisiae

Alignment Length:353 Identity:90/354 (25%)
Similarity:148/354 (42%) Gaps:68/354 (19%)


  Fly    78 LSEIFDGLDHLIVEHTPKIEDSYLALP----FGQVRSKAYR--------TWMREMYQHVFSKLDE 130
            |..:.|.|.|||.|..|        ||    :|.:..:.:.        .|::||....:.::  
Yeast    70 LMGVLDKLAHLIDETPP--------LPGPRRYGNLACREWHHKLDERLPQWLQEMLPSEYHEV-- 124

  Fly   131 AINVNCKHINELGQYLRRSFGNGNTLDFGPANELMFLFFLCGLFRAGILLAKDTVAAALMLFNRY 195
                    :.||..||..|||:...||:|..:||.|:..:..|...| :......|...:|||:|
Yeast   125 --------VPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDMLG-MFPHMRGADVFLLFNKY 180

  Fly   196 VNVVRRLISTYGLTIAKDPACT-----IEDYYFLPYLWGAAQ---LSVDSPFSPMQCEQGKIMDN 252
            ..::||||.||.|    :||.:     ::|::.|.|:.|::|   |...:|..|.:.....::..
Yeast   181 YTIMRRLILTYTL----EPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVRE 241

  Fly   253 YRQDFMMLEIIDHLQKTRSGPLSRVALQLWSI-LSIPTWPQVYRGLERNYIDHVLSSFGTVEQAI 316
            |:......:.|:.:.:.:.||....:..|:.| :::|.|.:|.:||.:.|...||..|..|:...
Yeast   242 YKDTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPVVQHFW 306

  Fly   317 FCELMSFEAVVPIMPLQRAHLGTHLIVDEKENEDELEQ----KYGENRWSLSPPVSRYVSMEPES 377
            |     .....|.:.:|.   ||.|.|.|::.|:.:||    ..|..:.|...|.|  .||.|..
Yeast   307 F-----GTGFFPWVNIQN---GTDLPVFEEKEEESIEQANAGSPGREQTSTRFPTS--TSMPPPG 361

  Fly   378 ----------FLGFQASKTHNKSKESED 395
                      .|..|.....|::..|.|
Yeast   362 VPPSGNNINYLLSHQNQSHRNQTSFSRD 389

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8509NP_573079.1 PTPA 27..324 CDD:281137 68/267 (25%)
RRD1NP_012113.1 LAG1 1..387 CDD:227390 88/350 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C161033222
eggNOG 1 0.900 E1_COG5057
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S1048
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002142
OrthoInspector 1 1.000 T634860
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10012
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.750

Return to query results.
Submit another query.