DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8509 and AT4G08960

Sequence 1:NP_573079.1 Gene:CG8509 FlyBaseID:FBgn0030696 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_567342.1 Gene:AT4G08960 AraportID:AT4G08960 Length:392 Species:Arabidopsis thaliana

Alignment Length:304 Identity:75/305 (25%)
Similarity:151/305 (50%) Gaps:17/305 (6%)


  Fly    27 PVKQVRSLEDLDRWVRSQAYYDIIAYISNTSKAIQGHRLTQTFPVTEQMRRLSEIFDGLDHLIVE 91
            |||::.|.:|:.|:..|.:..:.:.::.:.|::|:|.:::....::..:..:..|.:.|...|.|
plant    99 PVKRIHSPDDIRRFHESASCKNFLGFVVSLSESIRGFKISDPCHISPTVAAIVSILETLLQWIDE 163

  Fly    92 HTPKIEDSYLALPFGQVRSKAYRTWMREMYQHVFSKLDEAINVNCKH-INELGQYLRRSFGNGNT 155
            ..|..:.:    .:|.|   ::|:|...:.:...|.:.|.:....|. :.|:..|...||||.:.
plant   164 IPPAQQSA----RYGNV---SFRSWHERLRERGESLILEFLPEEFKESVIEIVPYFFDSFGNSSR 221

  Fly   156 LDFGPANELMFLFFLCGLFRAGILLAKDTVAAALMLFNRYVNVVRRLISTYGLTIAKDPACT--- 217
            :|:|..:|..|..:|..|.|.||:..:|..:....:|.:|:.::|:|...|.|    :||.:   
plant   222 IDYGTGHETNFAAWLYCLARMGIVKEEDYHSLVARVFVKYLELMRKLQMVYCL----EPAGSHGV 282

  Fly   218 --IEDYYFLPYLWGAAQLSVDSPFSPMQCEQGKIMDNYRQDFMMLEIIDHLQKTRSGPLSRVALQ 280
              ::||:|||:::|::||.......|.......|::|:..::|.|..|..::|.:.|..:..:..
plant   283 WGLDDYHFLPFIFGSSQLIDHKYMKPKSIHNDDILENFSSEYMYLSCIAFVKKVKKGLFAEHSPL 347

  Fly   281 LWSILSIPTWPQVYRGLERNYIDHVLSSFGTVEQAIFCELMSFE 324
            |..|..:|.|.:|..||.:.|...||.....::..:|..|:.:|
plant   348 LDDISGVPNWKKVNSGLLKMYRVEVLEKVPIMQHFLFGWLIKWE 391

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8509NP_573079.1 PTPA 27..324 CDD:281137 74/303 (24%)
AT4G08960NP_567342.1 PTPA 99..392 CDD:281137 75/305 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1165705at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10012
Phylome 1 0.910 0.667 Consistency score
44.030

Return to query results.
Submit another query.