DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8509 and PTPA

Sequence 1:NP_573079.1 Gene:CG8509 FlyBaseID:FBgn0030696 Length:432 Species:Drosophila melanogaster
Sequence 2:XP_011517136.1 Gene:PTPA HGNCID:9308 Length:463 Species:Homo sapiens

Alignment Length:406 Identity:115/407 (28%)
Similarity:195/407 (48%) Gaps:85/407 (21%)


  Fly    27 PVKQVRSLEDLDRWVRSQAYYDIIAYISNTSKAIQGHRLTQTFPVTEQMRRLSEIFDGLDHLIVE 91
            |.|::.::.|:.:|.|||||.|.|.:|...::.::|.:||..:.|:|.:.:|..:.:.||..|.|
Human    76 PKKEIHTVPDMGKWKRSQAYADYIGFILTLNEGVKGKKLTFEYRVSEAIEKLVALLNTLDRWIDE 140

  Fly    92 HTPKIEDSYLALPFGQVRSKAYRTWMREMYQHVFSKLDE-----AINVNCKH----INELGQYLR 147
            ..|..:.|    .||   :||||||        ::||||     ...|...|    :.|:..||:
Human   141 TPPVDQPS----RFG---NKAYRTW--------YAKLDEEAENLVATVVPTHLAAAVPEVAVYLK 190

  Fly   148 RSFGNGNTLDFGPANELMFLFFLCGLFRAGILLAKDTVAAALMLFNRYVNVVRRLISTYGLTIAK 212
            .|.||...:|:|..:|..|..|||.|.:.|:|...|.:|....:||||:.|:|:|..||.:    
Human   191 ESVGNSTRIDYGTGHEAAFAAFLCCLCKIGVLRVDDQIAIVFKVFNRYLEVMRKLQKTYRM---- 251

  Fly   213 DPACT-----IEDYYFLPYLWGAAQLSVDSPF-SPMQCEQGKIMDNYRQDFMMLEIIDHLQKTRS 271
            :||.:     ::|:.|||::||::|| :|.|: .|......|.::...:|:|.||.|..:.:.::
Human   252 EPAGSQGVWGLDDFQFLPFIWGSSQL-IDHPYLEPRHFVDEKAVNENHKDYMFLECILFITEMKT 315

  Fly   272 GPLSRVALQLWSILSIPTWPQVYRGLERNYIDHVLSSFGTVEQAIFCELMSFEAVVPIMPLQRAH 336
            ||.:..:.|||:|.::|:|.:|.:||.|.|...|...:                  |:.|    .
Human   316 GPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAEVSGGW------------------PVCP----S 358

  Fly   337 LGTHLIVDEKENEDELEQKYGENR----W------------SLSP-PVSRYVSMEPESFLGFQAS 384
            |..||::.           :|:::    |            :|.| |::...|..|...:|.|.|
Human   359 LLPHLVLG-----------WGQSKRCGTWGSCFLLPHCFALNLRPAPLTLGASESPIWGMGSQRS 412

  Fly   385 KTHNKSKESEDERLWM 400
            .:|...::.:...:.|
Human   413 TSHPSPEKLQSSSVLM 428

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8509NP_573079.1 PTPA 27..324 CDD:281137 98/312 (31%)
PTPAXP_011517136.1 PTPA 76..355 CDD:281137 99/317 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C161020978
eggNOG 1 0.900 E1_COG5057
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S1048
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1165705at2759
OrthoFinder 1 1.000 FOG0002142
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10012
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
87.760

Return to query results.
Submit another query.