DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8509 and ptpa

Sequence 1:NP_573079.1 Gene:CG8509 FlyBaseID:FBgn0030696 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_001003425.2 Gene:ptpa ZFINID:ZDB-GENE-040801-11 Length:324 Species:Danio rerio

Alignment Length:317 Identity:100/318 (31%)
Similarity:169/318 (53%) Gaps:35/318 (11%)


  Fly    27 PVKQVRSLEDLDRWVRSQAYYDIIAYISNTSKAIQGHRLTQTFPVTEQMRRLSEIFDGLDHLIVE 91
            |.|::..:.|:.:|.|||||.|.|.:|...::.::|.:||..:.|:|.:.:|..:...||..|.|
Zfish    28 PKKEISMVPDMGKWKRSQAYADYIGFILTLNEGVKGKKLTCEYQVSETVEKLLALLGTLDQWIDE 92

  Fly    92 HTPKIEDSYLALPFGQVRSKAYRTWMREMYQHVFSKLDEAINVNCKHI---------NELGQYLR 147
            ..|..:.|    .||   :||:|||        ::|||:........:         .|:..||:
Zfish    93 TPPVDQPS----RFG---NKAFRTW--------YAKLDQEAEALVAGVLPAERQDAAPEIAVYLK 142

  Fly   148 RSFGNGNTLDFGPANELMFLFFLCGLFRAGILLAKDTVAAALMLFNRYVNVVRRLISTYGLTIAK 212
            .|.||...:|:|..:|..|..|||.|.:.|.|..:|.:|....:|::|:.|:|:|..||.:    
Zfish   143 ESVGNSTRIDYGTGHEAAFAAFLCCLCKVGALRMEDQLAIIFNVFDKYLRVMRKLQKTYRM---- 203

  Fly   213 DPACT-----IEDYYFLPYLWGAAQLSVDSP-FSPMQCEQGKIMDNYRQDFMMLEIIDHLQKTRS 271
            :||.:     ::|:.|||::||::|| :|.| ..|....:.|:::.|.||:|.||.|..:.:.::
Zfish   204 EPAGSQGVWGLDDFQFLPFIWGSSQL-IDHPTLEPRHFVEEKVVNEYHQDYMFLECIKFINEMKT 267

  Fly   272 GPLSRVALQLWSILSIPTWPQVYRGLERNYIDHVLSSFGTVEQAIFCELMSFEAVVP 328
            ||.:..:.|||:|.::|:|.:|.:||.|.|....|..|..::...|..|:|.:.|.|
Zfish   268 GPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAECLEKFPVIQHFKFGSLLSIQPVKP 324

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8509NP_573079.1 PTPA 27..324 CDD:281137 98/312 (31%)
ptpaNP_001003425.2 PTPA 28..321 CDD:281137 98/313 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C161021486
eggNOG 1 0.900 E1_COG5057
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1165705at2759
OrthoFinder 1 1.000 FOG0002142
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10012
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
76.810

Return to query results.
Submit another query.