DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8509 and Ptpa

Sequence 1:NP_573079.1 Gene:CG8509 FlyBaseID:FBgn0030696 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_001102047.1 Gene:Ptpa RGDID:1308354 Length:323 Species:Rattus norvegicus

Alignment Length:313 Identity:99/314 (32%)
Similarity:169/314 (54%) Gaps:25/314 (8%)


  Fly    27 PVKQVRSLEDLDRWVRSQAYYDIIAYISNTSKAIQGHRLTQTFPVTEQMRRLSEIFDGLDHLIVE 91
            |.|::.::.|:.:|.|||||.|.|.:|...::.::|.:||..:.|:|.:.:|..:.|.||..|.|
  Rat    26 PKKEIHTVPDMGKWKRSQAYADYIGFILTLNEGVKGKKLTFDYKVSEAIEKLVALLDTLDRWIDE 90

  Fly    92 HTPKIEDSYLALPFGQVRSKAYRTWMREMYQHVFSKLDEAINVN-CKHINELGQYLRRSFGNGNT 155
            ..|..:.|    .||   :||||||..::.|...:.:...|..| ...:.|:..||:.:.||...
  Rat    91 TPPVDQPS----RFG---NKAYRTWYAKLDQEAENLVATVIPTNLAAAVPEVAVYLKEAVGNSTR 148

  Fly   156 LDFGPANELMFLFFLCGLFRAGILLAKDTVAAALMLFNRYVNVVRRLISTYGLTIAKDPACT--- 217
            :|:|..:|..|..|||.|.:.|:|...|.||....:|:||:.|:|:|..||.:    :||.:   
  Rat   149 IDYGTGHEAAFAAFLCCLCKIGVLRVDDQVAIVFKVFDRYLEVMRKLQKTYRM----EPAGSQGV 209

  Fly   218 --IEDYYFLPYLWGAAQLSVDSP-FSPMQCEQGKIMDNYRQDFMMLEIIDHLQKTRSGPLSRVAL 279
              ::|:.|||::||::|| :|.| ..|......|.:....:|:|.|:.|..:.:.::||.:..:.
  Rat   210 WGLDDFQFLPFIWGSSQL-IDHPHLEPRHFVDEKAVSENHKDYMFLQCILFITEMKTGPFAEHSN 273

  Fly   280 QLWSILSIPTWPQVYRGLERNYIDHVLSSFGTVEQAIFCELMSFEAVVPIMPL 332
            |||:|.::|:|.:|.:||.|.|....|..|..::.      ..|.:::||.|:
  Rat   274 QLWNISAVPSWSKVNQGLIRMYKAECLEKFPVIQH------FKFGSLLPIHPV 320

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8509NP_573079.1 PTPA 27..324 CDD:281137 96/304 (32%)
PtpaNP_001102047.1 PTPA 26..316 CDD:281137 96/308 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C161018348
eggNOG 1 0.900 E1_COG5057
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1165705at2759
OrthoFinder 1 1.000 FOG0002142
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10012
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
65.900

Return to query results.
Submit another query.