DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8509 and Ptpa

Sequence 1:NP_573079.1 Gene:CG8509 FlyBaseID:FBgn0030696 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_523466.2 Gene:Ptpa FlyBaseID:FBgn0016698 Length:398 Species:Drosophila melanogaster

Alignment Length:316 Identity:125/317 (39%)
Similarity:188/317 (59%) Gaps:17/317 (5%)


  Fly    29 KQVRSLEDLDRWVRSQAYYDIIAYISNTSKAIQGHRLTQTFPVTEQMRRLSEIFDGLDHLIVEHT 93
            |:|::|.|:..|.:|:|::|:|.||:.||.||||.:.|.....:|.:::|..:||.|:.| ||..
  Fly    17 KKVQNLGDMGVWQKSRAFHDLIGYINGTSSAIQGIKTTDEIFESEMLKKLLRLFDALEKL-VEQN 80

  Fly    94 PKIEDSYLALPFGQVRSKAYRTWMREMYQHVFSKLDEAINVNCKHIN-ELGQYLRRSFGNGNTLD 157
            |.:|...   .||   :||||.|.:.|.:.:...|::.:..:.|... ||||||..||||...:|
  Fly    81 PPLEQPQ---RFG---NKAYRDWAQAMRELLPELLEQLLPDDKKRYQVELGQYLTESFGNATRID 139

  Fly   158 FGPANELMFLFFLCGLFRAGILLAKDTVAAALMLFNRYVNVVRRLISTYGLTIAKDPA-----CT 217
            :|..:||.||||||.||:|.||..:|.|:|||.|||||:.:.|:|..||.:    :||     .:
  Fly   140 YGTGHELSFLFFLCSLFKAEILQERDIVSAALRLFNRYLELARQLQRTYNM----EPAGSQGVWS 200

  Fly   218 IEDYYFLPYLWGAAQLSVDSPFSPMQCEQGKIMDNYRQDFMMLEIIDHLQKTRSGPLSRVALQLW 282
            ::|:.|:|::||:|||:|.|||.|.:.....|:..|:..||.:..||::.|.::|.....:.|||
  Fly   201 LDDFQFVPFIWGSAQLAVKSPFDPSKFVDEAIITEYKDHFMFISCIDYICKVKTGHFGEHSNQLW 265

  Fly   283 SILSIPTWPQVYRGLERNYIDHVLSSFGTVEQAIFCELMSFEAVVPIMPLQRAHLG 338
            ||..:|||.::..||.:.|...:||.|..::...|.|||:||.|.....|..|.||
  Fly   266 SITDVPTWAKINAGLVKMYQKEILSKFPVIQHVYFGELMTFEPVSSGTTLSNARLG 321

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8509NP_573079.1 PTPA 27..324 CDD:281137 119/301 (40%)
PtpaNP_523466.2 PTPA 17..308 CDD:281137 120/302 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C161009120
eggNOG 1 0.900 E1_COG5057
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S1048
OrthoDB 1 1.010 D1165705at2759
OrthoFinder 1 1.000 FOG0002142
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10012
RoundUp 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.