DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8509 and SPAC4F10.04

Sequence 1:NP_573079.1 Gene:CG8509 FlyBaseID:FBgn0030696 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_594747.1 Gene:SPAC4F10.04 PomBaseID:SPAC4F10.04 Length:325 Species:Schizosaccharomyces pombe

Alignment Length:335 Identity:90/336 (27%)
Similarity:151/336 (45%) Gaps:31/336 (9%)


  Fly     9 VTDPTVQLLRASAFMQNG----PVKQVRSLEDLDRWVRSQAYY---DIIAYISNTSKAIQGHRLT 66
            |.:.|:..|....|.::.    |.|.:....|:..:.:|:|||   |.:..::..|..:..:.:.
pombe     4 VDEKTILELENERFDESSQFKTPEKLIVEASDMTAFRQSKAYYRIFDFLQRLNIASVGVNDYHVE 68

  Fly    67 QTFPVTEQMRRLSEIFDGLDHLIVEHTPKIEDSYLALPFGQVRSKAYRTWMREMYQHVFSKLDEA 131
            .:..|.:.:|.|..:.:     |.:..|.....:   .||   :.|:|.|..::.......:|..
pombe    69 YSTRVEKLVRILCRVKE-----ITKTVPPASGRH---RFG---NPAFRIWHEKLRDSASQIMDII 122

  Fly   132 INVNCKHIN-ELGQYLRRSFGNGNTLDFGPANELMFLFFLCGLFRAGILLAKDTVAAALMLFNRY 195
            |..:..... ||..|...||||...:|||..:||.||.|:.||...|:|.|.|..|.||.:.:.|
pombe   123 IPDSLSKAKVELLDYFLGSFGNSQRIDFGTGHELNFLGFIKGLDLLGLLDAADYKAIALYITHVY 187

  Fly   196 VNVVRRLISTYGLTIAKDPACT-----IEDYYFLPYLWGAAQL---SVDSPFSPMQCEQGKIMDN 252
            :.|.|.|:.||.|    :||.:     ::|::|:||::|:|||   :..|...|......||:|.
pombe   188 LEVCRELVQTYRL----EPAGSHGVWGLDDHFFIPYIFGSAQLADKASSSIIKPDAILNKKIVDE 248

  Fly   253 YRQDFMMLEIIDHLQKTRSGPLSRVALQLWSILSIPTWPQVYRGLERNYIDHVLSSFGTVEQAIF 317
            .....:....|..:...:.||....:..|:.|.::|.|.:|.:||.:.|...|||.:..|:...|
pombe   249 KANSNLYFSAIKFINVMKKGPFYEHSPILYDITAVPIWSKVNQGLIKMYDVEVLSKYPVVQHFHF 313

  Fly   318 CELMSFEAVV 327
            ..|..|..:|
pombe   314 GNLFPFNPLV 323

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8509NP_573079.1 PTPA 27..324 CDD:281137 85/309 (28%)
SPAC4F10.04NP_594747.1 LAG1 18..325 CDD:227390 86/322 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002142
OrthoInspector 1 1.000 T631731
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10012
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.980

Return to query results.
Submit another query.