DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8509 and SPAC1782.05

Sequence 1:NP_573079.1 Gene:CG8509 FlyBaseID:FBgn0030696 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_594712.1 Gene:SPAC1782.05 PomBaseID:SPAC1782.05 Length:352 Species:Schizosaccharomyces pombe

Alignment Length:315 Identity:82/316 (26%)
Similarity:149/316 (47%) Gaps:31/316 (10%)


  Fly    27 PVKQVRSLEDLDRWVRSQAYYDIIAYISNTSKAIQGHRLTQTFPVTEQMRRLSEIFDGLDHLIVE 91
            ||:::...|||..:....||..|.::|.:..:|::...::.:.|.:..:..:..|.|.:.. |.:
pombe    13 PVRRILDNEDLKLFKEGDAYKLIDSFICDLDEAVKDKPISASIPQSSSIEHVLNILDRVGE-IKQ 76

  Fly    92 HTPKIEDSYLALPFGQVRSKAYRTWMREMYQHVFSKLDEAINVNCKHINELGQYLRRSFGNGNTL 156
            ..|.|::  :...||   :.|::::..::|... .||.:...:......|.|:|...||||...:
pombe    77 ENPAIDN--MGSRFG---NPAFQSFYDQVYIET-PKLHQVFGIEHNAAMEAGRYFYESFGNRKRI 135

  Fly   157 DFGPANELMFLFFLCGLFRAGILLAKDTVAAALMLFNRYVNVVRRLISTYGLTIAKDPACT---- 217
            |:|..:||.|:.:|..|.:.||....|..|..:.:|.:||.::|.|...|.|    :||.:    
pombe   136 DYGSGHELYFMSWLLILKQLGIFTKNDYPALVVRVFVKYVELMRSLQIFYTL----EPAGSHGVW 196

  Fly   218 -IEDYYFLPYLWGAAQLSVDSPFSPMQCEQGKIMDNYRQDFMMLEIIDHLQKTRSGPLSRVALQL 281
             ::|::|||:|:|||||.......|......:|::..|.|:|.|..:..|.|.:..    |:|:.
pombe   197 GLDDFHFLPFLFGAAQLVNHKYLRPKHVRDPEILEMCRADYMYLGYVYFLNKLKPS----VSLRF 257

  Fly   282 WS-----ILSIPTWPQVYRGLERNYIDHVLSSFGTVEQAIFCELMSFEAVVPIMP 331
            .|     |.::.||.:|..|:.:.|...||.....::..:|..|      :|..|
pombe   258 HSPMIDDISAVKTWSKVNEGMIKMYRAEVLGKLPIMQHYLFGHL------IPASP 306

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8509NP_573079.1 PTPA 27..324 CDD:281137 80/307 (26%)
SPAC1782.05NP_594712.1 LAG1 2..352 CDD:227390 82/316 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002142
OrthoInspector 1 1.000 T631739
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10012
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
55.070

Return to query results.
Submit another query.