DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8509 and Y71H2AM.20

Sequence 1:NP_573079.1 Gene:CG8509 FlyBaseID:FBgn0030696 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_497617.1 Gene:Y71H2AM.20 WormBaseID:WBGene00022185 Length:375 Species:Caenorhabditis elegans

Alignment Length:307 Identity:83/308 (27%)
Similarity:152/308 (49%) Gaps:22/308 (7%)


  Fly    27 PVKQVRSLEDLDRWVRSQAYYDIIAYISNTSKAIQGHRLTQTFPVTEQMRRLSEIFDGLDHLIVE 91
            |.|.::::.||:.|..|:||.:.:|::...:.::.|...|.....|:.:....::.|.|:.. .|
 Worm     9 PEKMIKNVFDLNPWYFSKAYEEYLAFLHRLNDSVVGVHTTADMRCTDLVISFIDMLDKLEKW-AE 72

  Fly    92 HTPKIEDSYLALPFGQVRSKAYRTWMREMYQH----VFSKLDEAINVNCKHINELGQYLRRSFGN 152
            ..| :|| .....||   :||||.:..::.:.    :.|.|.|.::   ..:.||..|...||||
 Worm    73 EIP-LED-VSEQRFG---NKAYRKFYEKLCKESPDLLASVLPENVH---DALVELVPYFTESFGN 129

  Fly   153 GNTLDFGPANELMFLFFLCGLFRAGILLAKDTVAAALMLFNRYVNVVRRLISTYGLTIAKDPACT 217
            ...:|:|..:|..||..|..|.:.|:....|.....|.:||:|:.|.|.|.:.:.:    :||.:
 Worm   130 ATRIDYGSGHEANFLILLFCLQKLGVFTENDDKVLVLRIFNKYLRVCRHLQTRFKM----EPAGS 190

  Fly   218 -----IEDYYFLPYLWGAAQLSVDSPFSPMQCEQGKIMDNYRQDFMMLEIIDHLQKTRSGPLSRV 277
                 |:|:.|.|:::|:|||.......|....:..|::.:....:.|:.::.:.:|::||....
 Worm   191 RGVHAIDDFQFAPFIFGSAQLIGSKSIVPDSYLKKNIVETHAHTSLFLDCVNFINQTKTGPFHEH 255

  Fly   278 ALQLWSILSIPTWPQVYRGLERNYIDHVLSSFGTVEQAIFCELMSFE 324
            :.|||:|.::|.|.:|..|:.:.|...||..|..|:..:|..|.||:
 Worm   256 SNQLWNISAVPHWKKVNSGMFKMYEGEVLKKFPVVQHMMFGSLFSFD 302

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8509NP_573079.1 PTPA 27..324 CDD:281137 83/306 (27%)
Y71H2AM.20NP_497617.1 PTPA 9..303 CDD:281137 83/308 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C161021229
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1165705at2759
OrthoFinder 1 1.000 FOG0002142
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10012
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.