DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8509 and Ptpa

Sequence 1:NP_573079.1 Gene:CG8509 FlyBaseID:FBgn0030696 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_001349662.1 Gene:Ptpa MGIID:1346006 Length:325 Species:Mus musculus

Alignment Length:339 Identity:107/340 (31%)
Similarity:175/340 (51%) Gaps:48/340 (14%)


  Fly    10 TDPTVQLLRASAFMQNGPVKQVRSLEDLDRWVRSQAYYDIIAYISNTSKAIQGHRLTQTFPVTEQ 74
            |.||.|....       |.|::.::.|:.:|.|||||.|.|.:|...::.::|.:||..:.|:|.
Mouse    16 TPPTTQNFII-------PKKEIHTVPDMGKWKRSQAYADYIGFILTLNEGVKGKKLTFDYKVSEA 73

  Fly    75 MRRLSEIFDGLDHLIVEHTPKIEDSYLALPFGQVRSKAYRTWMREMYQHVFSKLD-EAIN----V 134
            :.:|..:.|.||..|.|..|..:.|    .||   :||||||        ::||| ||.|    |
Mouse    74 IEKLVALLDTLDRWIDETPPVDQPS----RFG---NKAYRTW--------YAKLDQEAENLVATV 123

  Fly   135 NCKH----INELGQYLRRSFGNGNTLDFGPANELMFLFFLCGLFRAGILLAKDTVAAALMLFNRY 195
            ...|    :.|:..||:.:.||...:|:|..:|..|..|||.|.:.|:|...|.||....:|:||
Mouse   124 VPTHLAAAVPEVAVYLKEAVGNSTRIDYGTGHEAAFAAFLCCLCKIGVLRVDDQVAIVFKVFDRY 188

  Fly   196 VNVVRRLISTYGLTIAKDPACT-----IEDYYFLPYLWGAAQL-SVDSP-FSPMQCEQGKIMDNY 253
            :.|:|:|..||.:    :||.:     ::|:.|||::||::|| ..:.| ..|......|.:...
Mouse   189 LEVMRKLQKTYRM----EPAGSQGVWGLDDFQFLPFIWGSSQLIGTNHPHLEPRHFVDEKAVSEN 249

  Fly   254 RQDFMMLEIIDHLQKTRSGPLSRVALQLWSILSIPTWPQVYRGLERNYIDHVLSSFGTVEQAIFC 318
            .:|:|.|:.|..:.:.::||.:..:.|||:|.::|:|.:|.:||.|.|....|..|..::.    
Mouse   250 HKDYMFLQCILFITEMKTGPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAECLEKFPVIQH---- 310

  Fly   319 ELMSFEAVVPIMPL 332
              ..|.:::||.|:
Mouse   311 --FKFGSLLPIHPV 322

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8509NP_573079.1 PTPA 27..324 CDD:281137 100/313 (32%)
PtpaNP_001349662.1 PTPA 26..319 CDD:308619 101/318 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C161020171
eggNOG 1 0.900 E1_COG5057
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S1048
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002142
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10012
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.750

Return to query results.
Submit another query.