DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8509 and ptpa

Sequence 1:NP_573079.1 Gene:CG8509 FlyBaseID:FBgn0030696 Length:432 Species:Drosophila melanogaster
Sequence 2:XP_004916736.1 Gene:ptpa XenbaseID:XB-GENE-970102 Length:360 Species:Xenopus tropicalis

Alignment Length:357 Identity:103/358 (29%)
Similarity:174/358 (49%) Gaps:75/358 (21%)


  Fly    27 PVKQVRSLEDLDRWVRSQAYYDIIAYISNTSKAIQGHRLTQTFPVTEQM---------------- 75
            |.|::..:.|:.:|.|||||.|.:.::...::.::|.:||..:.|:|::                
 Frog    28 PKKEINMVPDMMKWKRSQAYTDYMGFVLALNEGVKGKKLTDDYKVSERLFQEGTGDRRAGAGNGF 92

  Fly    76 --------------------RRLSEIFDGLDHLIVEHTPKIEDSYLALPFGQVRSKAYRTWMREM 120
                                .:|..:.|.|:..|.|..|..:.|    .||   :||:|||    
 Frog    93 FCGGSASSGEGQQIGWRVVIHKLMSLLDTLNRWIDEMPPVDQPS----RFG---NKAFRTW---- 146

  Fly   121 YQHVFSKLD-EAIN----VNCKHIN----ELGQYLRRSFGNGNTLDFGPANELMFLFFLCGLFRA 176
                ::||| ||.|    |...|::    |:..||:.|.||...:|:|..:|..|..|||.|.:.
 Frog   147 ----YAKLDKEAENLVSTVIPVHLSAAVPEVAVYLKESVGNSTRIDYGTGHEAAFAAFLCCLCKI 207

  Fly   177 GILLAKDTVAAALMLFNRYVNVVRRLISTYGLTIAKDPACT-----IEDYYFLPYLWGAAQLSVD 236
            |||...|.:|....:||||:.|:|:|..||.:    :||.:     ::|:.|||::||:|||...
 Frog   208 GILKVDDQLAIVFRVFNRYLEVMRKLQKTYRM----EPAGSQGVWGLDDFQFLPFIWGSAQLIDH 268

  Fly   237 SPFSPMQCEQGKIMDNYRQDFMMLEIIDHLQKTRSGPLSRVALQLWSILSIPTWPQVYRGLERNY 301
            |...|......|:::.:.:|:|.||.|..:.:.::||.:..:.|||:|.::|.|.:|.:||.|.|
 Frog   269 SILEPRHFVDEKVVNEHHKDYMFLECILFITEMKTGPFAEHSNQLWNISAVPAWSKVNQGLIRMY 333

  Fly   302 IDHVLSSFGTVEQAIFCELMSFEAVVPIMPLQ 333
            ....|..|..::.      ..|.:::||.|::
 Frog   334 KAECLEKFPVIQH------FKFGSLLPIQPVK 359

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8509NP_573079.1 PTPA 27..324 CDD:281137 100/347 (29%)
ptpaXP_004916736.1 PTPA 28..357 CDD:281137 102/354 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C161017449
eggNOG 1 0.900 E1_COG5057
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1165705at2759
OrthoFinder 1 1.000 FOG0002142
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.720

Return to query results.
Submit another query.