DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rhp and RHPN2

Sequence 1:NP_511168.3 Gene:Rhp FlyBaseID:FBgn0026374 Length:718 Species:Drosophila melanogaster
Sequence 2:NP_149094.3 Gene:RHPN2 HGNCID:19974 Length:686 Species:Homo sapiens

Alignment Length:682 Identity:261/683 (38%)
Similarity:382/683 (56%) Gaps:66/683 (10%)


  Fly    31 FVRGSDPRAATCRSKLQNRRCKLNKEINKELRLRAGAENLYKATSNRKLRDTVALELSFVNSNLQ 95
            |.:|.:|.|.|.||||||:|..||::|.|.:|:|.|||||.|..:|.|:|:.|.||||||||:||
Human    21 FRKGCNPLAQTGRSKLQNQRAALNQQILKAVRMRTGAENLLKVATNSKVREQVRLELSFVNSDLQ 85

  Fly    96 LLKEQLAELNSSVEIYQSESHNGIMPMIPLGLKETKEINFMEPFSDFILEHYSEEPSMYIDAIAD 160
            :|||:|..||.||.:||:......:|:|||||||||:::|.....|||||||||:..:|.|.|||
Human    86 MLKEELEGLNISVGVYQNTEEAFTIPLIPLGLKETKDVDFAVVLKDFILEHYSEDGYLYEDEIAD 150

  Fly   161 MTDTRQASKTPSRDALGVALLFRYYNTLYYVERRFFPPDRNLGVYFEWYDSLTGVPSCQRTIAFE 225
            :.|.|||.:|||||..||.||..|:..|.:||.|||||.|.:|:.|.|||||||||..|:.:..|
Human   151 LMDLRQACRTPSRDEAGVELLMTYFIQLGFVESRFFPPTRQMGLLFTWYDSLTGVPVSQQNLLLE 215

  Fly   226 KACTLFNLGGIYTQIGARHDRTTERGLDLAVDSFLRAAGVFRHIYDTFTNAPSMDLKPQVLDVLV 290
            ||..|||.|.:|||||.|.||.|:.||:.|:|:|.|||||..::.||||:.||.|:.|.:|.|||
Human   216 KASVLFNTGALYTQIGTRCDRQTQAGLESAIDAFQRAAGVLNYLKDTFTHTPSYDMSPAMLSVLV 280

  Fly   291 SLMLSQARECLFEKLQLQIEAMSHDCQAFRDLAGEAAQISHEYNEMHKNIQANDTHTYLPECWAG 355
            .:||:||:|.:|||:.|  ..:.::......:|.|||::...|.::|..:........:|..||.
Human   281 KMMLAQAQESVFEKISL--PGIRNEFFMLVKVAQEAAKVGEVYQQLHAAMSQAPVKENIPYSWAS 343

  Fly   356 LVPVKAELYKAFAHFYKARSIDATDELKASKSSQKNQESFIGNSQE--VERITTADYGASDEAST 418
            |..|||..|.|.||::.|  |...|......:...:||..:....:  .|.:|......:|:...
Human   344 LACVKAHHYAALAHYFTA--ILLIDHQVKPGTDLDHQEKCLSQLYDHMPEGLTPLATLKNDQQRR 406

  Fly   419 SIANKLAHLKEALASIEEAQRLQRMCRFLKNKASLTEVMKEVHSKSQEELEKFRLQASAKNIEDG 483
            .:..  :||:.|:|..||:.|...:|:.|::    .||:::|...:|   |:.|| ..|::.|:.
Human   407 QLGK--SHLRRAMAHHEESVREASLCKKLRS----IEVLQKVLCAAQ---ERSRL-TYAQHQEED 461

  Fly   484 DLLE----RSVEASSKFTLSLTGPDFTSHKVKDPFKRLGPIAIFSARRHWTAPRCVRLQKGSSLY 544
            |||.    .||.|.::..:.:..|.|:...|.|.|::|||:::|||.:.||.||.:|...     
Human   462 DLLNLIDAPSVVAKTEQEVDIILPQFSKLTVTDFFQKLGPLSVFSANKRWTPPRSIRFTA----- 521

  Fly   545 HSVPSNDNKCPLDNDDDEEHDGGYNLYKEEFENFGFHVRGDAPVIIAHVEINSLADLGGIKEGDF 609
                             ||.|            .||.:||:|||.:..::....|.:.|.:|||:
Human   522 -----------------EEGD------------LGFTLRGNAPVQVHFLDPYCSASVAGAREGDY 557

  Fly   610 IVEIAGVDVKWYSHQQVVQLIQSCG-STLELRVITPMDRNYLKPLSSKGSLSTLSAASSSGISSG 673
            ||.|..||.||.:..:|::|::|.| ..:|::|::.:|        |..|:...||..|.|:...
Human   558 IVSIQLVDCKWLTLSEVMKLLKSFGEDEIEMKVVSLLD--------STSSMHNKSATYSVGMQKT 614

  Fly   674 FPSPTSIAAKPKLHLKTSSSSRPAGSVSSSSW 705
            :   :.|........||..:.:.:..:|..||
Human   615 Y---SMICLAIDDDDKTDKTKKISKKLSFLSW 643

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RhpNP_511168.3 HR1_Rhophilin-1 34..118 CDD:212023 47/84 (56%)
BRO1_Rhophilin 122..514 CDD:185767 159/398 (40%)
PDZ_signaling 570..642 CDD:238492 25/73 (34%)
RHPN2NP_149094.3 HR1_Rhophilin-2 27..108 CDD:212024 46/81 (57%)
Interaction with Rho 46..66 10/20 (50%)
BRO1_Rhophilin_2 112..496 CDD:185772 159/398 (40%)
PDZ_signaling 514..591 CDD:238492 31/111 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C284693540
eggNOG 1 0.900 E1_KOG2220
Hieranoid 1 1.000
Homologene 1 1.000 H12407
Inparanoid 1 1.050 413 1.000 Inparanoid score I1833
Isobase 1 0.950 0 Normalized mean entropy S4559
OMA 1 1.010
OrthoDB 1 1.010 D286986at33208
OrthoFinder 1 1.000 FOG0002677
OrthoInspector 1 1.000 T610384
orthoMCL 1 0.900 OOG5_132236
Panther 1 1.100 O PTHR23031
Phylome 1 0.910 0.812 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5869
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.