DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rhp and Rhpn2

Sequence 1:NP_511168.3 Gene:Rhp FlyBaseID:FBgn0026374 Length:718 Species:Drosophila melanogaster
Sequence 2:NP_082173.3 Gene:Rhpn2 MGIID:1289234 Length:686 Species:Mus musculus

Alignment Length:681 Identity:260/682 (38%)
Similarity:379/682 (56%) Gaps:102/682 (15%)


  Fly    17 ENEDDEKLNELSFCFVRGSDPRAATCRSKLQNRRCKLNKEINKELRLRAGAENLYKATSNRKLRD 81
            |.|.|:       .|.:|.:|.|.|.||||||:|..||::|.|.:|:|.|||||.|..:|:|:|:
Mouse    14 EKEGDD-------YFRKGCNPLAQTGRSKLQNQRAALNQQILKAVRMRTGAENLLKVATNQKVRE 71

  Fly    82 TVALELSFVNSNLQLLKEQLAELNSSVEIYQSESHNGIMPMIPLGLKETKEINFMEPFSDFILEH 146
            .|.||||||||:||:|||:|..||.||.:||.......:|:||||||||||::|...|.||||||
Mouse    72 QVRLELSFVNSDLQMLKEELEGLNISVGVYQGTEEAFTIPLIPLGLKETKEVDFSIVFKDFILEH 136

  Fly   147 YSEEPSMYIDAIADMTDTRQASKTPSRDALGVALLFRYYNTLYYVERRFFPPDRNLGVYFEWYDS 211
            |||:..:|.|.|||:.|.|||.:|||||..||.||..|:..|.:||.|||||.|::|:.|.||||
Mouse   137 YSEDSYLYEDDIADLMDLRQACRTPSRDEAGVELLMSYFIQLGFVESRFFPPTRHMGLLFTWYDS 201

  Fly   212 LTGVPSCQRTIAFEKACTLFNLGGIYTQIGARHDRTTERGLDLAVDSFLRAAGVFRHIYDTFTNA 276
            .||||..|:|:..|||..|||:|.:|||||.|.:|.|:.||:.|||:|.|||||..::.:|||:.
Mouse   202 FTGVPVSQQTLLLEKASVLFNIGALYTQIGTRCNRQTQAGLESAVDAFQRAAGVLNYLKETFTHT 266

  Fly   277 PSMDLKPQVLDVLVSLMLSQARECLFEKLQLQIEAMSHDCQAFRDLAGEAAQISHEYNEMHKNIQ 341
            ||.|:.|.:|.|||.:||:||:|.:|||:.|  ..:.::......:|.|||:::..|.::|..:.
Mouse   267 PSYDMSPAMLSVLVKMMLAQAQESVFEKVCL--PGIQNEFFVLVKVAQEAAKVAEAYRQLHAAMS 329

  Fly   342 ANDTHTYLPECWAGLVPVKAELYKAFAHFYKARSIDATDELKASKSSQKNQESFIGNSQEVERIT 406
            .......:|..||.:..|||..|.|.||:: |.::....:||.. :.:.:||..:  ||..:|: 
Mouse   330 QEPVKENIPYSWASVAYVKAYHYGALAHYF-AATLLIDHQLKPG-ADEDHQEKCL--SQLYDRM- 389

  Fly   407 TADYGASDEASTSIAN-KLA---------HLKEALASIEEAQRLQRMCRFLKNKASLTEVMKEVH 461
                   .|..|.:|. |.|         ||..|:...||:.|...:|:.|::...|.:|:...|
Mouse   390 -------PEGMTPLATLKNAGQRVLLGKGHLHRAIGFHEESLREANLCKKLRDIQVLRDVLSAAH 447

  Fly   462 SKSQEELEKFRLQASAKNIEDGDLL------------ERSVEASSKFTLSLTGPDFTSHKVKDPF 514
            .::|.:..:.|        ||.|||            ||.|:        :|.|||:...|.|.|
Mouse   448 QRTQLKHTQHR--------EDDDLLNLIDAPDVLPKTEREVK--------ITFPDFSKVTVTDFF 496

  Fly   515 KRLGPIAIFSARRHWTAPRCVRLQKGSSLYHSVPSNDNKCPLDNDDDEEHDGGYNLYKEEFENFG 579
            ::|||:::|||.:.|:.||        .::.:|...|                          .|
Mouse   497 QKLGPLSVFSASKRWSPPR--------GIHFTVEEGD--------------------------LG 527

  Fly   580 FHVRGDAPVIIAHVEINSLADLGGIKEGDFIVEIAGVDVKWYSHQQVVQLIQSC-GSTLELRVIT 643
            |.:||:.||.:..::.:..|.|.|.||||:||.|.|||.||.:..:|::|::|. |..:|::|::
Mouse   528 FTLRGNTPVQVHFLDPHCSASLAGAKEGDYIVSIQGVDCKWLTVSEVMKLLKSFGGEEVEMKVVS 592

  Fly   644 PMDRNYLKPLSSKGSLSTLSAASSSGISSGF 674
            .:|        |..|:....|..|.|:...:
Mouse   593 LLD--------STSSMHNKCATYSVGMQKTY 615

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RhpNP_511168.3 HR1_Rhophilin-1 34..118 CDD:212023 47/84 (56%)
BRO1_Rhophilin 122..514 CDD:185767 163/414 (39%)
PDZ_signaling 570..642 CDD:238492 27/73 (37%)
Rhpn2NP_082173.3 HR1_Rhophilin-2 27..108 CDD:212024 46/81 (57%)
Interaction with Rho. {ECO:0000250} 46..66 10/20 (50%)
BRO1_Rhophilin_2 112..496 CDD:185772 163/414 (39%)
PDZ_signaling 522..591 CDD:238492 28/95 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C284717038
eggNOG 1 0.900 E1_KOG2220
Hieranoid 1 1.000
Homologene 1 1.000 H12407
Inparanoid 1 1.050 418 1.000 Inparanoid score I1787
Isobase 1 0.950 0 Normalized mean entropy S4559
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002677
OrthoInspector 1 1.000 T617189
orthoMCL 1 0.900 OOG5_132236
Panther 1 1.100 O PTHR23031
Phylome 1 0.910 0.812 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5869
TreeFam 00.000 Not matched by this tool.
1312.780

Return to query results.
Submit another query.