DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rhp and rhpn1

Sequence 1:NP_511168.3 Gene:Rhp FlyBaseID:FBgn0026374 Length:718 Species:Drosophila melanogaster
Sequence 2:NP_001008116.1 Gene:rhpn1 XenbaseID:XB-GENE-970431 Length:706 Species:Xenopus tropicalis

Alignment Length:717 Identity:275/718 (38%)
Similarity:396/718 (55%) Gaps:93/718 (13%)


  Fly    33 RGSDPRAATCRSKLQNRRCKLNKEINKELRLRAGAENLYKATSNRKLRDTVALELSFVNSNLQLL 97
            :|.||.|.|.|||||:||.::|::||||:|:|||||||::||:|.|:|:|||||||:||||||||
 Frog    23 KGCDPFAQTQRSKLQHRRARINQQINKEMRMRAGAENLFRATTNHKVRETVALELSYVNSNLQLL 87

  Fly    98 KEQLAELNSSVEIYQSESHNGIMPMIPLGLKETKEINFMEPFSDFILEHYSEEPSMYIDAIADMT 162
            ||:|.||||||||||:||....:||||||||||||::..:...|||:.||.::.::|...|.:..
 Frog    88 KEELEELNSSVEIYQNESDAINVPMIPLGLKETKELDLTDALKDFIVHHYGDDGTLYDKEIREFM 152

  Fly   163 DTRQASKTPSRDALGVALLFRYYNTLYYVERRFFPPDRNLGVYFEWYDSLTGVPSCQRTIAFEKA 227
            |.|||.:||||...|:.||..|||.||:::.|||||::.|||:|.|||||||||||||.:||||.
 Frog   153 DLRQAMRTPSRSDAGIELLMEYYNQLYFLDNRFFPPNKPLGVFFHWYDSLTGVPSCQRALAFEKG 217

  Fly   228 CTLFNLGGIYTQIGARHDRTTERGLDLAVDSFLRAAGVFRHIYDTFTNAPSMDLKPQVLDVLVSL 292
            ..|||:|.:|||||||.||.:..|:|.|:|:|.:|||.|.::.:.|:||||:|:....|.:||.|
 Frog   218 SVLFNMGALYTQIGARQDRLSVEGVDTAIDAFQKAAGCFSYLKENFSNAPSLDMSTASLSMLVRL 282

  Fly   293 MLSQARECLFEKLQLQIEAMSHDCQAFRDLAGEAAQISHEYNEMHKNIQANDTHTYLPECWAGLV 357
            |::|.:||:|||..||........|.  ..|.|||::...|..:::.:.......|:|..|:.:|
 Frog   283 MVAQVQECIFEKFVLQNPRSDFFTQL--QAAQEAARVEEVYTLVYRTMTQPPVKDYIPFSWSTMV 345

  Fly   358 PVKAELYKAFAHFYKARSIDATDELKASKSSQKNQESFIGNSQEVERITTADYGAS------DEA 416
            .||||.::|.:|:|.|.::  .|...||::..|.||.......     .||..|.|      |..
 Frog   346 HVKAEHFRALSHYYAACAL--CDYSTASEAEVKTQEKAFSQFH-----VTAPEGPSVGFVLQDPE 403

  Fly   417 STSIANKLAHLKEALASIEEAQRLQRMCRFLKNKASLTEVMKEVHSKSQEELEKFRLQASAKNIE 481
            ......| ||||:|:...|||.|:..:.:.|:....|.||:...|.:|   |.|:      .:|:
 Frog   404 ERRKLGK-AHLKKAIMKHEEAMRIHVLSKILRKMDILQEVLTLTHKQS---LSKY------SDID 458

  Fly   482 DGDLLERSVEASSKFTLSLTGPD-----FTSHKVKDPFKRLGPIAIFSARRHWTAPRCVRLQKGS 541
            ..:....:.||.....::...|:     |:..|..|.|.||||:::|||:..|..|:.|.|:|| 
 Frog   459 HEEDFFETGEAPDIQPITCQRPEIKTPVFSKVKATDIFHRLGPLSVFSAKHKWRPPQKVHLEKG- 522

  Fly   542 SLYHSVPSNDNKCPLDNDDDEEHDGGYNLYKEEFENFGFHVRGDAPVIIAHVEINSLADLGGIKE 606
                              ||               .|||.:||||||::|.:.....|...|:.|
 Frog   523 ------------------DD---------------GFGFTLRGDAPVLVAGIVPGGCAAEAGVME 554

  Fly   607 GDFIVEIAGVDVKWYSHQQVVQLIQSCGST-LELRVITPMDRNYLKPLSSKGSLSTLS-AASSSG 669
            ..:||.::|.|.:|..|.||||.::..|.. :::.|:  :.:|....:...|..|:.| ...:.|
 Frog   555 NSYIVSVSGADCRWAKHAQVVQQLKDAGEDGVDIEVV--VFQNPETQIMLWGPQSSFSWQRGAHG 617

  Fly   670 ISSGFPSPTSIAAKPKLHL--------------------KTSSSSRPAGSVSSSS---WNPFRRT 711
            .:...|......|.|.|.|                    |.::.....||.|:|:   |:  :|:
 Frog   618 WAGHVPQQWDYNASPSLSLSQVVDKRASMLTACELLRGNKENNKKSILGSKSASALRLWS--KRS 680

  Fly   712 PS 713
            .|
 Frog   681 KS 682

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RhpNP_511168.3 HR1_Rhophilin-1 34..118 CDD:212023 60/84 (71%)
BRO1_Rhophilin 122..514 CDD:185767 155/403 (38%)
PDZ_signaling 570..642 CDD:238492 25/73 (34%)
rhpn1NP_001008116.1 HR1_Rhophilin-1 24..108 CDD:212023 60/84 (71%)
BRO1_Rhophilin_1 112..496 CDD:185771 155/403 (38%)
PDZ_signaling 514..591 CDD:238492 32/111 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 450 1.000 Inparanoid score I1481
OMA 1 1.010
OrthoDB 1 1.010 D286986at33208
OrthoFinder 1 1.000 FOG0002677
OrthoInspector 1 1.000 T602222
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5869
TreeFam 00.000 Not matched by this tool.
77.100

Return to query results.
Submit another query.