DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rhp and brox

Sequence 1:NP_511168.3 Gene:Rhp FlyBaseID:FBgn0026374 Length:718 Species:Drosophila melanogaster
Sequence 2:NP_001007428.2 Gene:brox ZFINID:ZDB-GENE-041114-137 Length:411 Species:Danio rerio

Alignment Length:453 Identity:92/454 (20%)
Similarity:155/454 (34%) Gaps:155/454 (34%)


  Fly   127 LKETKEINF------MEPFSDFILEHYSEEPSMYIDAIADMTDTRQASKTPSRDALGVALLFRYY 185
            ||.|..::|      ..|.::.|........:..:|...|.|.:....|..|.:..  |||..:.
Zfish    10 LKATAPVSFNLYGVASSPAANKICNDLRTARARLLDMFTDATCSPDTLKKSSDEYF--ALLQGFI 72

  Fly   186 ---------NTLYYVERRFFPPDRNLGVYFEWYDSLTG-VPSCQRTIAFEKACTLFNLGGIYTQI 240
                     |.|.:::.            |:|.|:|.| :.|.|:...||.....||:...||:.
Zfish    73 LPLDGTTQENKLRFIQN------------FKWTDTLQGNIASAQQDAVFELVSMAFNVALWYTKF 125

  Fly   241 GAR----HDRTTERGLDLAVDSFLRAAGVFR-----HIYDTFTNA-PSMDLKPQVLDVLVSLMLS 295
            .:|    .:.|.|...|:. .|...|||:|:     ||....|.| ...||:|:|:|..:....:
Zfish   126 ASRLAGKENITEEEAKDVH-KSLKIAAGIFKTLKETHIPRLITPAEKGRDLEPRVIDTYIVQSQA 189

  Fly   296 QARECLFEKLQLQIEAMSHDCQAFRDLAGEAAQISHEYNEMHKNIQANDTHTYLPEC---WAGLV 357
            :|:|....:   .|| :.|:......||.|.|..   |.:....:...|     |||   |...:
Zfish   190 EAQEVTIAR---AIE-LKHNASLIAALAFETANF---YQKADHTLNTLD-----PECSSKWKKYL 242

  Fly   358 PVKAELYKAFAHFYKARSIDATDELKASKSSQKNQESFIGNSQEVERITTADYGASDEASTSIAN 422
            .:|...|.|:||.|..:::.|.|:                                         
Zfish   243 QLKQHFYMAYAHCYHGQTLLAGDK----------------------------------------- 266

  Fly   423 KLAHLKEALASIEEAQRLQRMCRFLKNKASLTEVMKEVHSKSQEELEKFRLQASAKNIEDGDLLE 487
                ..||:.|::||::    |                :|:::...:::|               
Zfish   267 ----CGEAIRSLQEAEK----C----------------YSRAEVLCKEYR--------------- 292

  Fly   488 RSVEASSKFTLSLTGPDFTSHKVKDP-FKRLGPIAIFSARRHWTAPRCVRLQKGSSLYHSVPS 549
                       .:.||..|:...:.. ||:||.:.      ..|..:|.| :.|...:|.||:
Zfish   293 -----------QMKGPGSTAKPSEQLFFKKLGAVI------KNTLEKCQR-ENGFIYFHKVPA 337

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RhpNP_511168.3 HR1_Rhophilin-1 34..118 CDD:212023
BRO1_Rhophilin 122..514 CDD:185767 81/417 (19%)
PDZ_signaling 570..642 CDD:238492
broxNP_001007428.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.