DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rhp and Brox

DIOPT Version :8

Sequence 1:NP_511168.3 Gene:Rhp / 32531 FlyBaseID:FBgn0026374 Length:718 Species:Drosophila melanogaster
Sequence 2:NP_001020840.1 Gene:Brox / 305031 RGDID:1307161 Length:411 Species:Rattus norvegicus

Alignment Length:333 Identity:70/334 (21%)
Similarity:130/334 (39%) Gaps:96/334 (29%)


  Fly   154 YIDAIADMTDTRQASKTPSRDALGVALLFRYYNTLYYVERRFFPPDRNLGVYFEWYDSLTG-VPS 217
            :|:::.|.|   |.||                  |.|::.            |:|.|:|.| |||
  Rat    71 FINSVGDST---QESK------------------LRYIQN------------FKWTDTLQGHVPS 102

  Fly   218 CQRTIAFEKACTLFNLGGIYTQIGAR---HDRTTERGLDLAVDSFLRAAGVFRHIYDTFTNAPSM 279
            .|:...||.....||:...||:..:|   .:..||........|...|||:|:|:.:  ::.|.:
  Rat   103 AQQDAVFELISMGFNVALWYTKYASRLAGKENITEDEAKEVHRSLKIAAGIFKHLKE--SHIPKL 165

  Fly   280 --------DLKPQVLDVLVSLMLSQARECLFEK-LQLQ-----IEAMSHDCQAFRDLAGEAAQIS 330
                    ||:.:::|..:....::|:|....: ::|:     |.|::::..:|...|      .
  Rat   166 LTPAEKGRDLEARLIDAYIIQCQAEAQEVTIARAIELKHAPGLIAALAYETASFYQKA------D 224

  Fly   331 HEYNEMHKNIQANDTHTYLPECWAGLVPVKAELYKAFAHFYKARSIDATDEL-KASKSSQKNQES 394
            |..:.:.....|.         |...:.:|...|.|:|:.|..:::.|:|:. :|.:|.|:.::.
  Rat   225 HTLSSLEPAHSAK---------WRKYLHLKMCFYTAYAYCYHGQTLLASDKCGEAIRSLQEAEKL 280

  Fly   395 FIGNSQEVERITTADYGASDEASTSIANKLAHLKEALASIEEAQRLQRMCRFLKNKASLTEVMKE 459
            :    .|.|.: ..:||.: :.....|....||                  |.:...||   :|.
  Rat   281 Y----AEAEAL-CKEYGET-KGPGPTAKPSGHL------------------FFRKLGSL---VKN 318

  Fly   460 VHSKSQEE 467
            ...|.|.|
  Rat   319 TLDKCQRE 326

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RhpNP_511168.3 HR1_Rhophilin-1 34..118 CDD:212023
BRO1_Rhophilin 122..514 CDD:185767 70/334 (21%)
PDZ_signaling 570..642 CDD:238492
BroxNP_001020840.1 BRO1_Brox_like 4..356 CDD:185766 70/334 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.