DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rhp and PTPN23

Sequence 1:NP_511168.3 Gene:Rhp FlyBaseID:FBgn0026374 Length:718 Species:Drosophila melanogaster
Sequence 2:NP_056281.1 Gene:PTPN23 HGNCID:14406 Length:1636 Species:Homo sapiens

Alignment Length:758 Identity:167/759 (22%)
Similarity:284/759 (37%) Gaps:204/759 (27%)


  Fly   120 MPMIPLGLKETKEINFMEPFSDFILEHYSEEPSMYIDAIADMTDTRQASKTPSRDALGVALLFRY 184
            ||||.|.|||..:.:|......|:|::|.|.|..|.:.:..:...||.:....||..|.::|.:|
Human     7 MPMIWLDLKEAGDFHFQPAVKKFVLKNYGENPEAYNEELKKLELLRQNAVRVPRDFEGCSVLRKY 71

  Fly   185 YNTLYYVERRF-FPPDRNLGVYFEWYDSLTGVPSCQRTIAFEKACTLFNLGGIYTQIGARHDRTT 248
            ...|:|::.|. ....:...|...|.:..:|.......|.:|:||.|:|||.:::.:||...|.:
Human    72 LGQLHYLQSRVPMGSGQEAAVPVTWTEIFSGKSVAHEDIKYEQACILYNLGALHSMLGAMDKRVS 136

  Fly   249 ERGLDLAVDSFLRAAGVFRHIYDTFTNAPSMDLKPQVLDVLVSLMLSQARECLFEKLQLQIEAMS 313
            |.|:.::...|..|||.|.::.:.|..|.|:|:..|:|.:.|:|||.||:|||.||      :|.
Human   137 EEGMKVSCTHFQCAAGAFAYLREHFPQAYSVDMSRQILTLNVNLMLGQAQECLLEK------SML 195

  Fly   314 HDCQAFRDLAGEAAQISHEYNEMHKNIQANDTHTYL---PECWAGLVPVKAELYKAFAHFYKARS 375
            .:.::|. :|..:||:...|.|..:.::..||.:.|   .:.|..||.:|...:.|.||.:..:.
Human   196 DNRKSFL-VARISAQVVDYYKEACRALENPDTASLLGRIQKDWKKLVQMKIYYFAAVAHLHMGKQ 259

  Fly   376 ID--------------ATDELKASKSSQKNQESFIGNSQEVERITTADYGASDEASTSIANKLAH 426
            .:              |.|:|..:....|.|...:   |:..|.|....|....::....:.:.|
Human   260 AEEQQKFGERVAYFQSALDKLNEAIKLAKGQPDTV---QDALRFTMDVIGGKYNSAKKDNDFIYH 321

  Fly   427 LKEALASIEEAQRLQ------------------------RMCRFLKNKAS----------LTEVM 457
              ||:.:::..|.::                        ::.....::||          |.|:|
Human   322 --EAVPALDTLQPVKGAPLVKPLPVNPTDPAVTGPDIFAKLVPMAAHEASSLYSEEKAKLLREMM 384

  Fly   458 KEVHSKSQEELEKF--RLQASAKNIEDGD--------LLER------------------------ 488
            .::..|: |.|::|  .:|...:.:::.|        |:|:                        
Human   385 AKIEDKN-EVLDQFMDSMQLDPETVDNLDAYSHIPPQLMEKCAALSVRPDTVRNLVQSMQVLSGV 448

  Fly   489 --SVEASSKFTLSLTGPD-FTSHKVKDPFKRLGPIAIFS------ARRHWT-------------- 530
              .||||.|....|...| ....|.::...:.|.|:|.|      .||.|.              
Human   449 FTDVEASLKDIRDLLEEDELLEQKFQEAVGQAGAISITSKAELAEVRREWAKYMEVHEKASFTNS 513

  Fly   531 -APRCVRLQKGSSLYHSVP-------------SNDNKCPLDN----------------------- 558
             ..|.:.|..|:....|.|             |.::|..|.|                       
Human   514 ELHRAMNLHVGNLRLLSGPLDQVRAALPTPALSPEDKAVLQNLKRILAKVQEMRDQRVSLEQQLR 578

  Fly   559 -----DD------DEEHDGGYNLYKEEFENFGFHVRGDAPVIIAHVEINSLAD---LGGIKEGDF 609
                 ||      ..:|.....|::|:.:.:        ..:..::|.|..|.   |..:.|.: 
Human   579 ELIQKDDITASLVTTDHSEMKKLFEEQLKKY--------DQLKVYLEQNLAAQDRVLCALTEAN- 634

  Fly   610 IVEIAGV-------DVKWYSHQQVVQLIQSCGSTLELRVITPMDRNYLKPLSSK------GSLST 661
             |:.|.|       |.||.|..|.  |:.|..:..:|...:...|::...|.||      .:.||
Human   635 -VQYAAVRRVLSDLDQKWNSTLQT--LVASYEAYEDLMKKSQEGRDFYADLESKVAALLERTQST 696

  Fly   662 LSAASSSGIS------SGFPSPTSIAAKPKLHLKTSSSSRPAG 698
            ..|..::...      ...|.|...|.||.|..:..|.:..||
Human   697 CQAREAARQQLLDRELKKKPPPRPTAPKPLLPRREESEAVEAG 739

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RhpNP_511168.3 HR1_Rhophilin-1 34..118 CDD:212023
BRO1_Rhophilin 122..514 CDD:185767 112/481 (23%)
PDZ_signaling 570..642 CDD:238492 18/82 (22%)
PTPN23NP_056281.1 BRO1_HD-PTP_like 2..357 CDD:185762 93/362 (26%)
TPR 1 250..283 6/33 (18%)
V_HD-PTP_like 362..700 CDD:185747 65/351 (19%)
TPR 2 374..407 8/34 (24%)
ALIX_LYPXL_bnd 417..701 CDD:290660 54/296 (18%)
His 770..1130
6 X 2 AA approximate tandem repeats of P-Q 953..964
Y_phosphatase 1220..1450 CDD:278528
PTPc 1220..1449 CDD:238006
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2220
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.