DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rhp and SPAC17G6.05c

Sequence 1:NP_511168.3 Gene:Rhp FlyBaseID:FBgn0026374 Length:718 Species:Drosophila melanogaster
Sequence 2:NP_594252.1 Gene:SPAC17G6.05c PomBaseID:SPAC17G6.05c Length:775 Species:Schizosaccharomyces pombe

Alignment Length:440 Identity:104/441 (24%)
Similarity:170/441 (39%) Gaps:115/441 (26%)


  Fly   121 PMIPLGLKETKEINFMEPFSDFILEHYSEEPSMYIDAIADMTDTRQASKTPSRDA-------LGV 178
            |...|..||||..:::|||:.|:...|...        .|:.|..:|..|...:|       .|.
pombe     7 PFFYLNKKETKHSDWVEPFTTFVSRIYGNS--------VDVEDQIKAFNTLRENAADVDDTVAGK 63

  Fly   179 ALLFRYYNTLYYVERRFFPPDRNLGVYFEWYDSLTGVPSC----QRTIAFEKACTLFNLGGIYTQ 239
            .:|:.||..|.|:..||......:.:.|||.|.|.  |..    |.::|||||..||||..:.::
pombe    64 DILYSYYGQLDYLSFRFPTGGNGINISFEWSDILD--PDADFVKQSSLAFEKASVLFNLVSLLSR 126

  Fly   240 IGARHDRTTERGLDLAVDSFLRAA-------GVFRHIYDTFTNAPSMDLKPQVLDVLVSLMLSQA 297
            :.|.|...      ..||.:..||       |:.:.:.::|.:||..||....|..:.:|.|.||
pombe   127 MAANHASA------YTVDDYKAAANCLQCASGIAKLLRESFIHAPGRDLDSNFLLGIYNLFLGQA 185

  Fly   298 RECLFEKLQLQIEAMSHDCQAFRDLAGEAAQI----SHEYNEMHKNIQANDTHTYLPEC---WAG 355
            :||:...:.......:.:......:|..||.:    .|.:..|.            |.|   :..
pombe   186 QECVLGHMSFSASDSNMNYSLAAKIASSAATLYDSCVHAFESME------------PACNPNFIR 238

  Fly   356 LVPVKAELYKAFAHFYKARSIDATDELKASKSS-----QKNQESFIGNSQE-----------VER 404
            |...|....:.|:.::.||:     :|:.||..     .:..:|.:.::|:           :.:
pombe   239 LASAKKAALEGFSSYFMARA-----QLEKSKQGLAIGYLQQAKSILSSAQKLFNGIKLSTDFIHK 298

  Fly   405 ITTADYGASDEASTSIANKLAHLKEALASIEEAQRLQRMCRFLKNKASLTE-VMKEVHSKSQEEL 468
            .:.:||  ....||.|.:.|:||      ::.|::        .|.....: |:|||      ||
pombe   299 PSLSDY--PQTISTFIKSSLSHL------LKTAEK--------DNDFVFHDLVVKEV------EL 341

  Fly   469 EKFR-LQA-----------------SAKNIEDGDLLERSVEASSKFTLSL 500
            .|.. |||                 :||.|...||.:..|.::.....||
pombe   342 PKISPLQALPPLPLEKLYGSQDGFETAKKIVGDDLFKAFVPSAVTTASSL 391

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RhpNP_511168.3 HR1_Rhophilin-1 34..118 CDD:212023
BRO1_Rhophilin 122..514 CDD:185767 103/440 (23%)
PDZ_signaling 570..642 CDD:238492
SPAC17G6.05cNP_594252.1 BRO1_Alix_like 8..345 CDD:301330 92/392 (23%)
V_ScBro1_like 382..745 CDD:185750 2/11 (18%)
ALIX_LYPXL_bnd 439..748 CDD:290660
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.625 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.