DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rhp and Pdcd6ip

Sequence 1:NP_511168.3 Gene:Rhp FlyBaseID:FBgn0026374 Length:718 Species:Drosophila melanogaster
Sequence 2:XP_011241243.1 Gene:Pdcd6ip MGIID:1333753 Length:877 Species:Mus musculus

Alignment Length:655 Identity:151/656 (23%)
Similarity:252/656 (38%) Gaps:190/656 (29%)


  Fly   127 LKETKEINFMEPFSDFILEHY---SEEPSMYIDAIADMTDTRQASKTPSRDALGVAL-------- 180
            ||:|.|::..:|...||.:.|   .||.:.|..|..:::..|       |.|||..|        
Mouse     9 LKKTSEVDLAKPLVKFIQQTYPSGGEEQAQYCRAAEELSKLR-------RSALGRPLDKHEGALE 66

  Fly   181 -LFRYYNTLYYVERRFFPPDRNLGVYFEWYD-----SLTG--VPSCQRTIAFEKACTLFNLGGIY 237
             |.|||:.:..:|.:|...:..:.:.|.|.|     ||.|  |.....::.:||:|.|||...:.
Mouse    67 TLLRYYDQICSIEPKFPFSENQICLTFTWKDAFDKGSLFGGSVKLALASLGYEKSCVLFNCAALA 131

  Fly   238 TQIGARHDRTTERGLDLAVDSFLRAAGVFRHIYDTFTNA----PSMDLKPQVLDVLVSLMLSQAR 298
            :||.|..:...:.||..|...:..|:|.|.||.||..:|    |::|:.|..:..|..:||:||:
Mouse   132 SQIAAEQNLDNDEGLKTAAKQYQFASGAFLHIKDTVLSALSREPTVDISPDTVGTLSLIMLAQAQ 196

  Fly   299 ECLFEKLQLQIEAMSHDCQAFRD------LAGEAAQISHEYNEMHKNIQANDT---HTYLPECWA 354
            |..|.|             |.||      :|..|.|.:..:.:..|..|..||   :.|..|.:.
Mouse   197 EVFFLK-------------ATRDKMKDAIIAKLANQAADYFGDAFKQCQYKDTLPKYFYFQEVFP 248

  Fly   355 GLVPVKAELYKAFAHFYKARSIDATDELKASKSSQKNQESFIGNSQEVERITTADYGASDEASTS 419
            .|. .|..:.:|.|.::  :||.|           |.|:.|               |        
Mouse   249 TLA-AKQCIMQANAEYH--QSILA-----------KQQKKF---------------G-------- 276

  Fly   420 IANKLAHLKEALASIEEAQRLQRMCRFLKNKASLTEVMKEVHSKSQEELEKFRLQASAKNIEDGD 484
                           ||..|||.....:||.||..:  :.|:.|...:.....|.|:.|   |.|
Mouse   277 ---------------EEIARLQHAAELIKNVASRYD--EYVNVKDFSDKINRALTAAKK---DND 321

  Fly   485 LLE-------RSVEASSKFTLSLTGPDF--TSHKVKDPFKRLGPI------AIFSARRHWTAPRC 534
            .:.       :.::...|.||....|..  .|.|..|.|:::.|:      |:||.|:.....|.
Mouse   322 FIYHDRVPDLKDLDPIGKATLVKPTPVNVPVSQKFTDLFEKMVPVSVQQSLAVFSQRKADLVNRS 386

  Fly   535 V-RLQKGSSLYHSVPSNDNKCPLDNDDDEEHDGGYNLYKEEFENFGFHVRGDAPVIIAHVEINSL 598
            : ::::.::|.:.|.::.| .|...:|                     |.||........:..|:
Mouse   387 IAQMREATTLANGVLASLN-LPAAIED---------------------VSGDTVPQSILTKSTSV 429

  Fly   599 ADLGGIKEGDFIVEIAGVDVKWYSHQQVVQLIQSCGSTLE--LRVI------------------- 642
            .:.|||:..|.::            :::.:|:|.....||  ||::                   
Mouse   430 VEQGGIQTVDQLI------------KELPELLQRNREILEESLRLLDEEEATDNDLRAKFKDRWQ 482

  Fly   643 -TPMDRNYLKPLSSKGS--LSTLSAA--SSSGISSGFPS---PTSIAAKPKLHLKTS-SSSRPAG 698
             ||.:..| |||.::|:  .:.|..|  :...:...:.|   ..::..||:..|..: .|:.||.
Mouse   483 RTPSNDLY-KPLRAEGAKFRAVLDKAVQADGQVKERYQSHRDTIALLCKPEPELNAAIPSANPAK 546

  Fly   699 SVSSS 703
            ::..|
Mouse   547 TMQGS 551

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RhpNP_511168.3 HR1_Rhophilin-1 34..118 CDD:212023
BRO1_Rhophilin 122..514 CDD:185767 108/428 (25%)
PDZ_signaling 570..642 CDD:238492 14/74 (19%)
Pdcd6ipXP_011241243.1 BRO1_Alix 2..350 CDD:185763 105/418 (25%)
V_Alix 365..703 CDD:185748 42/223 (19%)
ALIX_LYPXL_bnd 417..706 CDD:290660 28/149 (19%)
RCR <824..877 CDD:289075
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2220
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.