DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rhp and B0507.2

Sequence 1:NP_511168.3 Gene:Rhp FlyBaseID:FBgn0026374 Length:718 Species:Drosophila melanogaster
Sequence 2:NP_505261.2 Gene:B0507.2 WormBaseID:WBGene00015219 Length:427 Species:Caenorhabditis elegans

Alignment Length:507 Identity:97/508 (19%)
Similarity:178/508 (35%) Gaps:152/508 (30%)


  Fly    88 SFVNSNLQLLKEQLAELNSSVEIYQSESHNGIMPMIPLGLKE-TKEIN-FMEPFSDFILEHYSEE 150
            |.:...|:|.:::|      |..:::.|::         |:| |||.| ::..|:.|::|..|..
 Worm    30 SKICGELRLRRDKL------VSQFKNASND---------LEEVTKEFNEYLRLFAGFLIEIQSSM 79

  Fly   151 PSMYIDAIADMTDTRQASKTPSRDALGVALLFRYYNTLYYVERRFFPPDRNLGVYFEWYDSLTGV 215
            ..:         :.:.|....|:  |...:.|::.|::.        |.....|...|:::|:.:
 Worm    80 VEL---------ENKDAGNKNSK--LIPLIRFKWGNSML--------PQAATEVSDTWFEALSMI 125

  Fly   216 PSCQRTIAFEKACTLFNLGGIYTQIGARHDRTTERGLDLAVDSFLRAAGVFRHIYDTFT------ 274
             .|......:.|.::           |..|...|......:....:|.|:|:::.|..:      
 Worm   126 -QCMAMWLTKHAASM-----------AGKDEVRESDAKECLQCLRQAGGMFQYVKDESSRLSGAN 178

  Fly   275 NAPSMDLKPQVLDVLVSLMLSQARECLFEKLQLQIEAMSHDCQAFRDLAGEAAQISHEYNEMHKN 339
            .....|..|:|::..:....::|:|.:..:   .|| |.||......||...|.|..:.::...|
 Worm   179 EVEGSDFDPKVMETYILTATAEAQEVIVAR---AIE-MKHDDGLISSLAAVTASIFSKADQCLNN 239

  Fly   340 IQANDTHTYLPE----CWAGLVPVKAELYKAFAHFY---KARSIDATDE-LKASKSSQKNQESFI 396
                     ||:    .|...:.:|...|.|:|..:   |..|.|...| ::|.|..        
 Worm   240 ---------LPDESFARWRRYLQLKHHFYLAYAFAFLGQKQLSEDKCGEAVRACKQG-------- 287

  Fly   397 GNSQEVERITTADYGASDEASTSIANKL---AHLKEALASIEEAQRLQRMCRFLKNKASLTEVMK 458
                      .|:||.:.|.:...|...   ..:|      .|.....|....|.|: .|.:..:
 Worm   288 ----------IAEYGVAKEMAAMYATATGPGTRIK------PEQHLFFRRIEPLLNR-HLEKAER 335

  Fly   459 E----VHSKSQEELEKFRLQAS---AKNIEDGDLLER----------SVEASSKFTLSLTG-PDF 505
            |    .|.|..:|:.:..::|:   ||       |:.          :....|.|.||... |||
 Worm   336 ENGFIYHQKVPDEIPQLDVEATYGLAK-------LDSFTYPPPAESWNTAVYSAFDLSKANMPDF 393

  Fly   506 TSHKVKDPFKRLGPI---AIFSARRHWTAPRCVRLQKGSSLYHSVPSNDNKC 554
            :  |:|....:|.|:   .|:...:.                   |||.:.|
 Worm   394 S--KIKKSKSKLDPVHEEKIYQTEKD-------------------PSNSSGC 424

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RhpNP_511168.3 HR1_Rhophilin-1 34..118 CDD:212023 6/30 (20%)
BRO1_Rhophilin 122..514 CDD:185767 84/429 (20%)
PDZ_signaling 570..642 CDD:238492
B0507.2NP_505261.2 BRO1_Brox_like 4..366 CDD:185766 81/427 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2220
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.