DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rhp and Rhpn1

Sequence 1:NP_511168.3 Gene:Rhp FlyBaseID:FBgn0026374 Length:718 Species:Drosophila melanogaster
Sequence 2:XP_006520510.1 Gene:Rhpn1 MGIID:1098783 Length:662 Species:Mus musculus

Alignment Length:673 Identity:249/674 (37%)
Similarity:365/674 (54%) Gaps:68/674 (10%)


  Fly    19 EDDEKLNELSFCFVRGSDPRAATCRSKLQNRRCKLNKEINKELRLRAGAENLYKATSNRKLRDTV 83
            :||..:.:....||:...       .:||:.|.:|:::|:||||:|.||||||:||||..:|:||
Mouse    20 QDDGSIRKGYGSFVQNQP-------GQLQSHRARLHQQISKELRMRTGAENLYRATSNTWVRETV 77

  Fly    84 ALELSFVNSNLQLLKEQLAELNSSVEIYQSESHNGIMPMIPLGLKETKEINFMEPFSDFILEHYS 148
            |||||:||||||||||:||||::||::.|.|.....:||||||||||||:::..|..:.|.||:.
Mouse    78 ALELSYVNSNLQLLKEELAELSTSVDVDQPEGEGITIPMIPLGLKETKELDWATPLKELISEHFG 142

  Fly   149 EEPSMYIDAIADMTDTRQASKTPSRDALGVALLFRYYNTLYYVERRFFPPDRNLGVYFEWYDSLT 213
            |:.:.:...|.::.|.|||::|||||..|:.||..||:.|.:::.|||.|.|:.|:.|.||||||
Mouse   143 EDGTSFETEIQELEDLRQATRTPSRDEAGLDLLAAYYSQLCFLDARFFSPSRSPGLLFHWYDSLT 207

  Fly   214 GVPSCQRTIAFEKACTLFNLGGIYTQIGARHDRTTERGLDLAVDSFLRAAGVFRHIYDTFTNAPS 278
            |||:.||.:||||...|||:|.::||||||.|.:...|.:.|.::|.||||.||.:.:.|::|||
Mouse   208 GVPAQQRALAFEKGSVLFNIGALHTQIGARQDCSCTEGTNHAAEAFQRAAGAFRLLRENFSHAPS 272

  Fly   279 MDLKPQVLDVLVSLMLSQARECLFEKLQLQIEAMSHDCQAFRDLAGEAAQISHEYNEMHKNIQAN 343
            .|:....|.:|..||::||:||:|:.|.|...|....|.....||.||||::.||..:|:.:...
Mouse   273 PDMSAASLSMLEQLMIAQAQECIFKGLLLPASATPDICPDQLQLAQEAAQVATEYGLVHRAMAQP 337

  Fly   344 DTHTYLPECWAGLVPVKAELYKAFAHFYKARSIDATDELKASKSSQKNQESFIGNSQEVERITTA 408
            ....|||..|..|..||||.:.|.||::.|.::  .:...|:|.....||.....|...|.:   
Mouse   338 PVRDYLPASWTNLAHVKAEHFCALAHYHAAMAL--CESHPAAKGELARQEHVFQPSTPHEPL--- 397

  Fly   409 DYGASDEASTSIANKL--AHLKEALASIEEAQRLQRMCRFLKNKASLTEVMKEVHSKSQEELEKF 471
              |.:.........||  ||||.|:...|||.||..:||.|: |..|.:|:  |....:..|.|:
Mouse   398 --GPTLPQHPEDRRKLAKAHLKRAILGQEEALRLHTLCRVLR-KVDLLQVV--VTQALRRSLAKY 457

  Fly   472 RLQASAKNIEDGDLLERS----VEASSKFTLSLTGPDFTSHKVKDPFKRLGPIAIFSARRHWTAP 532
                |....|| |..|.:    ::..:..|..:..|..:..||.|.|.||||:::||.:..|...
Mouse   458 ----SQLERED-DFFEATEAPDIQPKTHQTPEVRMPSLSQVKVTDFFHRLGPLSVFSTKNRWQLV 517

  Fly   533 RCVRLQKGSSLYHSVPSNDNKCPLDNDDDEEHDGGYNLYKEEFENFGFHVRGDAPVIIAHVEINS 597
            ..|.:.:|..                                  :|||.:|||:||:||.|....
Mouse   518 GPVHMTRGEG----------------------------------SFGFTLRGDSPVLIAAVVPGG 548

  Fly   598 LADLGGIKEGDFIVEIAGVDVKWYSHQQVVQLIQSCGST-LELRVITPMDRNYLKPLSSKGSLST 661
            .|:..|:||||:||.:.|...||:.|.:||..::|.|.. :.|:|:     :.|.....:|:...
Mouse   549 QAESAGLKEGDYIVSVNGQPCKWWKHLEVVTQLRSMGEEGVSLQVV-----SLLPSPEPRGTGPR 608

  Fly   662 LSAASSSGISSGFPSPTSIAAKP 684
            .:|...:....||.:|.....:|
Mouse   609 RAALLWNQRECGFETPMPTRTRP 631

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RhpNP_511168.3 HR1_Rhophilin-1 34..118 CDD:212023 46/84 (55%)
BRO1_Rhophilin 122..514 CDD:185767 152/398 (38%)
PDZ_signaling 570..642 CDD:238492 29/73 (40%)
Rhpn1XP_006520510.1 HR1_Rhophilin-1 28..112 CDD:212023 48/91 (53%)
BRO1_Rhophilin_1 116..499 CDD:185771 152/398 (38%)
PDZ_signaling 520..594 CDD:238492 31/108 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C284687719
eggNOG 1 0.900 E1_KOG2220
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 418 1.000 Inparanoid score I1787
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D286986at33208
OrthoFinder 1 1.000 FOG0002677
OrthoInspector 1 1.000 T617189
orthoMCL 1 0.900 OOG5_132236
Panther 1 1.100 LDO PTHR23031
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5869
TreeFam 1 0.960
1312.800

Return to query results.
Submit another query.