DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rhp and Ptpn23

Sequence 1:NP_511168.3 Gene:Rhp FlyBaseID:FBgn0026374 Length:718 Species:Drosophila melanogaster
Sequence 2:NP_001074512.1 Gene:Ptpn23 MGIID:2144837 Length:1692 Species:Mus musculus

Alignment Length:771 Identity:168/772 (22%)
Similarity:277/772 (36%) Gaps:227/772 (29%)


  Fly   120 MPMIPLGLKETKEINFMEPFSDFILEHYSEEPSMYIDAIADMTDTRQASKTPSRDALGVALLFRY 184
            ||||.|.|||..:.:|......|:|::|.|.|..|.:.:..:...||.:...:||..|.::|.:|
Mouse     7 MPMIWLDLKEAGDFHFQSAVKKFVLKNYGENPEAYNEELKKLELLRQNAIRVARDFEGCSVLRKY 71

  Fly   185 YNTLYYVERRF-FPPDRNLGVYFEWYDSLTGVPSCQRTIAFEKACTLFNLGGIYTQIGARHDRTT 248
            ...|:|::.|. ....:...|...|.:..:|.......|.:|:||.|:|||.:::.:||...|.:
Mouse    72 LGQLHYLQSRVPMGSGQEAAVAVTWTEIFSGKSVSHEDIKYEQACILYNLGALHSMLGAMDKRVS 136

  Fly   249 ERGLDLAVDSFLRAAGVFRHIYDTFTNAPSMDLKPQVLDVLVSLMLSQARECLFEKLQLQIEAMS 313
            |.|:.::...|..|||.|.::.:.|..|.|:|:..|:|.:.|:|||.||:|||.||      :|.
Mouse   137 EEGMKVSCTHFQCAAGAFAYLREHFPQAFSVDMSRQILTLNVNLMLGQAQECLLEK------SML 195

  Fly   314 HDCQAFRDLAGEAAQISHEYNEMHKNIQANDTHTYL---PECWAGLVPVKAELYKAFAHFYKARS 375
            .:.::|. :|..:||:...|.|..:.::..||.:.|   .:.|..||.:|...:.|.||.:..:.
Mouse   196 DNRKSFL-VARISAQVVDYYKEACRALENPDTASLLGRIQKDWKKLVQMKIYYFAAVAHLHMGKQ 259

  Fly   376 ID---------------------------------------ATDELKASKSSQKNQESFIGNSQE 401
            .:                                       |.|.:....:|.|....||.: :.
Mouse   260 AEEQQKFGERVAYFQSALDKLNEAIKLAKGQPDTVQDALRFAMDVIGGKYNSAKKDNDFIYH-EA 323

  Fly   402 VERITTAD--YGA----------SDEAST--SIANKL----AHLKEALASIEEAQRLQRMCRFLK 448
            |..:.|..  .||          :|.|.|  .|..||    ||...:|.|.|:|:.|:.|...::
Mouse   324 VPALDTLQPVKGAPLVKPLPVNPTDPAVTGPDIFAKLVPMAAHEASSLYSEEKAKLLREMLAKIE 388

  Fly   449 NKASLTEVMKEVHSKSQ------EELEKFR----------------------------------- 472
            :|   .||:.:.....|      :.|:.:.                                   
Mouse   389 DK---NEVLDQFMDSMQLDPETVDNLDAYNHIPPQLMEKCAALSVRPDTVKNLVQSMQVLSGVFT 450

  Fly   473 -LQASAKNIEDGDLLERSVEASSKF--TLSLTGPDFTSHKVKDPFKRLGPIAIFSARRHWT---- 530
             ::||.|:|.  ||||.......|.  ||...|        ..|...:....:...||.|.    
Mouse   451 DVEASLKDIR--DLLEEDELQEQKLQETLGQAG--------AGPGPSVAKAELAEVRREWAKYME 505

  Fly   531 -----------APRCVRLQKGSSLYHSVP-------------SNDNKCPLDN------------- 558
                       ..|.:.|..|:....|.|             :.::|..|.|             
Mouse   506 VHEKASFTNSELHRAMNLHVGNLRLLSGPLDQVRAALPTPALTPEDKAVLQNLKRILAKVQEMRD 570

  Fly   559 ---------------DD------DEEHDGGYNLYKEEFENFGFHVRGDAPVIIAHVEINSLAD-- 600
                           ||      ..:|.....|::|:.:.:        ..:..::|.|..|.  
Mouse   571 QRVSLEQQLRELIQKDDITASLVTTDHSEMKKLFEEQLKKY--------DQLKVYLEQNLAAQDN 627

  Fly   601 -LGGIKEGDFIVEIAGV-------DVKWYSHQQVVQLIQSCGSTLELRVITPMDRNYLKPLSSKG 657
             |..:.|.:  |:.|.|       |.||.|..|.  |:.|..:..:|...:...:::...|.|| 
Mouse   628 VLRALTEAN--VQYAAVRRVLSELDQKWNSTLQT--LVASYEAYEDLMKKSQEGKDFYADLESK- 687

  Fly   658 SLSTLSAASSS---------------GISSGFPSPTSIAAKPKLHLKTSSSSRPAG 698
             ::||...:.|               .:....|.|...|.||.|..:....:..||
Mouse   688 -VATLLERAQSICRAQEAARQQLLDRELKKKAPPPRPTAPKPLLSRREEGEAVEAG 742

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RhpNP_511168.3 HR1_Rhophilin-1 34..118 CDD:212023
BRO1_Rhophilin 122..514 CDD:185767 120/497 (24%)
PDZ_signaling 570..642 CDD:238492 18/82 (22%)
Ptpn23NP_001074512.1 BRO1_HD-PTP_like 2..357 CDD:185762 94/358 (26%)
TPR 1 250..283 3/33 (9%)
V_HD-PTP_like 362..702 CDD:185747 64/367 (17%)
TPR 2 374..407 8/36 (22%)
ALIX_LYPXL_bnd 417..703 CDD:290660 51/310 (16%)
His 773..1186
21 X 2 AA approximate tandem repeats of P-Q 977..1018
Y_phosphatase 1276..1506 CDD:278528
PTPc 1276..1505 CDD:238006
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2220
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.